DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment al and PAX7

DIOPT Version :9

Sequence 1:NP_722629.1 Gene:al / 33208 FlyBaseID:FBgn0000061 Length:408 Species:Drosophila melanogaster
Sequence 2:NP_002575.1 Gene:PAX7 / 5081 HGNCID:8621 Length:520 Species:Homo sapiens


Alignment Length:361 Identity:114/361 - (31%)
Similarity:150/361 - (41%) Gaps:99/361 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly    52 APSGASGASGGTNSPVSDGNSDCEADEYAP-KRKQRRYRTTFTSFQLEELEKAFSRTHYPDVFTR 115
            |.....|..|...:.:.:| ||.|::...| ||||||.|||||:.|||||||||.||||||::||
Human   184 AKHSIDGILGDKGNRLDEG-SDVESEPDLPLKRKQRRSRTTFTAEQLEELEKAFERTHYPDIYTR 247

  Fly   116 EELAMKIGLTEARIQVWFQNRRAKWRKQEKVGPQSHPYNPYLPGG--AATMQTVVGAALPPN--P 176
            ||||.:..|||||:||||.||||:||||.... |...:|..||||  ...|.|:....||.:  |
Human   248 EELAQRTKLTEARVQVWFSNRRARWRKQAGAN-QLAAFNHLLPGGFPPTGMPTLPPYQLPDSTYP 311

  Fly   177 FTHL----GFQLRKPF----DAQHAANLAAFRYPHLSAAPMIPSGYFNQFQRAPPHMLPHGMAGM 233
            .|.:    |..:.:|.    ...|...|||     .:||....|.|                 |.
Human   312 TTTISQDGGSTVHRPQPLPPSTMHQGGLAA-----AAAAADTSSAY-----------------GA 354

  Fly   234 YSPSSSFQSLLANMTAVPRGTPLGKPPALLVGSPDLHSPNHMLASPPTSPASGHASQHQQHPTAH 298
            ....||:.....|..|          |:           |||  :|.::..|........:|:|.
Human   355 RHSFSSYSDSFMNPAA----------PS-----------NHM--NPVSNGLSPQVMSILGNPSAV 396

  Fly   299 PPPPQAPPQMPVGVQPAQLSPQH-------LVGIALTQQASSLSPTQTSPVAL-----TLSHSPQ 351
            ||.|||         ...:||.|       .:..:.:|:|.|:.|..:.|.:.     |.|.:..
Human   397 PPQPQA---------DFSISPLHGGLDSATSISASCSQRADSIKPGDSLPTSQAYCPPTYSTTGY 452

  Fly   352 RQLPPPSHQ------------------APPPPPRAA 369
            ...|...:|                  .|.|.|||:
Human   453 SVDPVAGYQYGQYGQSECLVPWASPVPIPSPTPRAS 488

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
alNP_722629.1 Homeobox 89..141 CDD:278475 39/51 (76%)
OAR 374..391 CDD:281777
PAX7NP_002575.1 paired box domain 34..164
PAX 34..163 CDD:238076
octapeptide 86..93
paired homeodomain 217..275 44/57 (77%)
Homeobox 220..273 CDD:278475 39/52 (75%)
Pax7 347..385 CDD:289156 13/77 (17%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 389..409 8/28 (29%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000011
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.