DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment al and DPRX

DIOPT Version :10

Sequence 1:NP_722629.1 Gene:al / 33208 FlyBaseID:FBgn0000061 Length:408 Species:Drosophila melanogaster
Sequence 2:NP_001012746.1 Gene:DPRX / 503834 HGNCID:32166 Length:191 Species:Homo sapiens


Alignment Length:140 Identity:44/140 - (31%)
Similarity:65/140 - (46%) Gaps:24/140 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly    87 RYRTTFTSFQLEELEKAFSRTHYPDVFTREELAMKIGLTEARIQVWFQNRRAKWRK-------QE 144
            |.||.||..|||:|...|:...||:...::|:|.||.:....:||||:|.|||.:|       |:
Human    18 RKRTMFTKKQLEDLNILFNENPYPNPSLQKEMASKIDIHPTVLQVWFKNHRAKLKKAKCKHIHQK 82

  Fly   145 KVGPQSHPYNPYLP-GGAATMQTVVGA-ALP--PNPFTHLGFQLRKPFDAQHAANLAAFRYPHLS 205
            :..||     |.:| ||.:|...:..| .||  ||....:|.    .:......:.....||:|.
Human    83 QETPQ-----PPIPEGGVSTSVGLRNADTLPRLPNAAHPIGL----VYTGHRVPSFQLILYPNLK 138

  Fly   206 AAPMIPSGYF 215
                :|:..|
Human   139 ----VPANDF 144

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
alNP_722629.1 Homeodomain 86..142 CDD:459649 24/54 (44%)
OAR 374..391 CDD:461067
DPRXNP_001012746.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..20 1/1 (100%)
Homeodomain 18..73 CDD:459649 24/54 (44%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.