DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment al and Pax7

DIOPT Version :9

Sequence 1:NP_722629.1 Gene:al / 33208 FlyBaseID:FBgn0000061 Length:408 Species:Drosophila melanogaster
Sequence 2:XP_006239325.1 Gene:Pax7 / 500574 RGDID:1564360 Length:505 Species:Rattus norvegicus


Alignment Length:370 Identity:116/370 - (31%)
Similarity:153/370 - (41%) Gaps:80/370 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly    52 APSGASGASGGTNSPVSDGNSDCEADEYAP-KRKQRRYRTTFTSFQLEELEKAFSRTHYPDVFTR 115
            |.....|..|...:.:.:| ||.|::...| ||||||.|||||:.|||||||||.||||||::||
  Rat   184 AKHSIDGILGDKGNRLDEG-SDVESEPDLPLKRKQRRSRTTFTAEQLEELEKAFERTHYPDIYTR 247

  Fly   116 EELAMKIGLTEARIQVWFQNRRAKWRKQEKVGPQSHPYNPYLPGGAATMQTVVGAALPPNPFTHL 180
            ||||.:..|||||:||||.||||:||||.... |...:|..||||           .||.     
  Rat   248 EELAQRTKLTEARVQVWFSNRRARWRKQAGAN-QLAAFNHLLPGG-----------FPPT----- 295

  Fly   181 GFQLRKPFDAQHAANLAAFRYPHLSAAPMIPSGYFNQFQRAPPHMLPHGMAGMYSPSSSFQ-SLL 244
            |.....|:....:|      ||..:.:....|....      |..||        ||:..| .|.
  Rat   296 GMPTLPPYQLPDSA------YPTTTVSQDGGSTVHR------PQPLP--------PSTMHQGGLA 340

  Fly   245 ANMTAVPRGTPLGKPPALLVGSPDLHSP----NHMLASPPTSPASGHASQHQQHPTAHPPPPQAP 305
            |...|....:..|...:....|....:|    |||  :|.::..|........:|:|.||.||| 
  Rat   341 AAAAAADSSSAYGARHSFSSYSDSFMNPGAPSNHM--NPVSNGLSPQVMSILSNPSAVPPQPQA- 402

  Fly   306 PQMPVGVQPAQLSPQH-------LVGIALTQQASSLSPTQTSPVALTLSHSPQRQLPP----PSH 359
                    ...:||.|       .:..:.:|:|.|:.|..:.|.:       |...||    ..:
  Rat   403 --------DFSISPLHGGLDSASSISASCSQRADSIKPGDSLPTS-------QSYCPPTYSTTGY 452

  Fly   360 QAPPPP-------PRAATPPEDRRTSSIAALRLKAREHELKLELL 397
            ...|..       .:.|.....:..|.....|:|..||...|.||
  Rat   453 SVDPVAGYQYSQYGQTAVDYLAKNVSLSTQRRMKLGEHSAVLGLL 497

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
alNP_722629.1 Homeobox 89..141 CDD:278475 39/51 (76%)
OAR 374..391 CDD:281777 4/16 (25%)
Pax7XP_006239325.1 PAX 34..161 CDD:128645
Homeobox 220..274 CDD:395001 40/53 (75%)
Pax7 <354..385 CDD:403540 7/32 (22%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000011
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
32.910

Return to query results.
Submit another query.