Sequence 1: | NP_722629.1 | Gene: | al / 33208 | FlyBaseID: | FBgn0000061 | Length: | 408 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_001297007.1 | Gene: | alx4b / 497424 | ZFINID: | ZDB-GENE-050208-140 | Length: | 259 | Species: | Danio rerio |
Alignment Length: | 265 | Identity: | 56/265 - (21%) |
---|---|---|---|
Similarity: | 83/265 - (31%) | Gaps: | 114/265 - (43%) |
- Green bases have known domain annotations that are detailed below.
Fly 207 APMIPSGYFNQFQRAPPHMLPHGMAGMYSPSSSFQSLLANMTAVP-RGTPLGKPPALLVGSPDLH 270
Fly 271 SPNHMLASPPT---SPASGHASQH---QQHPTAHPPP-----------------PQAPP------ 306
Fly 307 ----------------QMPVGVQP---AQL-SPQHLVGIALTQQASSLSPTQTSPVALTLSHSPQ 351
Fly 352 RQLPPPSHQA---------PPPPPRAA----------------------TPPEDRRTSSIAALRL 385
Fly 386 KAREH 390 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
al | NP_722629.1 | Homeobox | 89..141 | CDD:278475 | |
OAR | 374..391 | CDD:281777 | 12/17 (71%) | ||
alx4b | NP_001297007.1 | OAR | 235..252 | CDD:281777 | 12/17 (71%) |
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 0 | 0.000 | Not matched by this tool. | |||
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 1 | 1.010 | - | - | D454642at33208 | |
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 1 | 1.100 | - | - | O | PTHR24329 |
Phylome | 1 | 0.910 | - | - | ||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
ZFIN | 0 | 0.000 | Not matched by this tool. | |||
3 | 3.020 |