DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment al and alx4b

DIOPT Version :9

Sequence 1:NP_722629.1 Gene:al / 33208 FlyBaseID:FBgn0000061 Length:408 Species:Drosophila melanogaster
Sequence 2:NP_001297007.1 Gene:alx4b / 497424 ZFINID:ZDB-GENE-050208-140 Length:259 Species:Danio rerio


Alignment Length:265 Identity:56/265 - (21%)
Similarity:83/265 - (31%) Gaps:114/265 - (43%)


- Green bases have known domain annotations that are detailed below.


  Fly   207 APMIPSGYFNQFQRAPPHMLPHGMAGMYSPSSSFQSLLANMTAVP-RGTPLGKPPALLVGSPDLH 270
            :|..|..  .:.|:|.|:.........|||           |.:| :|...|:.|         .
Zfish    20 SPAAPGQ--GRVQQANPYRTFQSSDSKYSP-----------TFLPAKGQTYGEKP---------R 62

  Fly   271 SPNHMLASPPT---SPASGHASQH---QQHPTAHPPP-----------------PQAPP------ 306
            ||.|.  ..||   |.|.|..|::   .|.|....|.                 .::|.      
Zfish    63 SPFHQ--DCPTLDDSTAEGAYSKYHLFMQRPACKSPSEDSKLEDGALISCYGVVSESPGKWRKRE 125

  Fly   307 ----------------QMPVGVQP---AQL-SPQHLVGIALTQQASSLSPTQTSPVALTLSHSPQ 351
                            ::|:..:|   ||: :|..|.|      :||.||.   |..:....:..
Zfish   126 RFGQMQQVRTHFSTAYELPLLTRPENYAQIQNPSWLSG------SSSASPV---PGCVVPCDTVS 181

  Fly   352 RQLPPPSHQA---------PPPPPRAA----------------------TPPEDRRTSSIAALRL 385
            ..:.|..|.|         |.|....|                      :...||::||||:||:
Zfish   182 SCMTPHPHSASGVSDFLGMPSPGGSMAQTHMGSLFGSSGVGGTINGYDLSVEPDRKSSSIASLRM 246

  Fly   386 KAREH 390
            ||:||
Zfish   247 KAKEH 251

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
alNP_722629.1 Homeobox 89..141 CDD:278475
OAR 374..391 CDD:281777 12/17 (71%)
alx4bNP_001297007.1 OAR 235..252 CDD:281777 12/17 (71%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D454642at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR24329
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
33.020

Return to query results.
Submit another query.