DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment al and repo

DIOPT Version :9

Sequence 1:NP_722629.1 Gene:al / 33208 FlyBaseID:FBgn0000061 Length:408 Species:Drosophila melanogaster
Sequence 2:NP_477026.1 Gene:repo / 47285 FlyBaseID:FBgn0011701 Length:612 Species:Drosophila melanogaster


Alignment Length:427 Identity:124/427 - (29%)
Similarity:168/427 - (39%) Gaps:121/427 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly    17 KLAHPDAVVLVDRAPGSSAASAGAALTV------------SMSVSGGAPSGASGASGGTNSPVS- 68
            ||..||.:.....|.|:......::.||            |.|.:|....||:|.:||..:|.: 
  Fly   223 KLKKPDEMCSQLEAGGAGVTPPSSSSTVVNGTTNGTGNANSSSSAGVGIQGAAGTAGGVAAPAAK 287

  Fly    69 -DGNSDCEADEYAPKR-KQRRYRTTFTSFQLEELEKAFSRTHYPDVFTREELAMKIGLTEARIQV 131
             ||:|..:..:  |.. |:::.|||||::||||||:||.|..|||||.|||||:|:.|:|:|:||
  Fly   288 KDGSSSKKKGD--PNGIKKKKTRTTFTAYQLEELERAFERAPYPDVFAREELAIKLNLSESRVQV 350

  Fly   132 WFQNRRAKWRKQEKVGPQSHPYNPYLPGGAATMQTVVGAALPP----NPFTHLGFQLRKPFDAQH 192
            |||||||||||.|.  |:...|              :..:.||    ||.|     |..||.:  
  Fly   351 WFQNRRAKWRKHEP--PRKTGY--------------IKTSTPPTATLNPGT-----LAPPFTS-- 392

  Fly   193 AANLAAFRYPHLSAAPMIPSGYFN-------------QFQRAPPHMLPHG-MAGMYSPSSSFQSL 243
                    ||..:.  :.|.|..:             ||....|...|:| .:|.|. :...:|.
  Fly   393 --------YPQTTT--VTPPGSMDSWTSYQTPYELTPQFSLLSPAASPYGTYSGQYG-AYVHESQ 446

  Fly   244 LANMTAVPRGTP----LGKPPALLVGSPDLHSPN--------------HMLASPPTSPASGHASQ 290
            |..|.....|:|    :|.....:.|:.|....|              ..||.........|..|
  Fly   447 LFPMRHYEYGSPTRMEMGATTGSVAGNGDESVANGGSYQTAELQTAQQQQLADGTLVTVHAHQQQ 511

  Fly   291 HQQHPTAHPPPPQAPPQMPVGVQPAQ------LSP-----------QHLVGIALTQQASSLSPT- 337
            .||....:.....|.....|.:|..|      |||           ||.|..| |..|:|...| 
  Fly   512 QQQQQQLNGKYLSAEEAKYVHLQCHQSGGGLELSPGASCHLVEAQGQHYVTTA-TGGAASAGGTS 575

  Fly   338 ---------QTSPVALTLSHSPQRQ------LPPPSH 359
                     ||...:..:|...|:|      |||..|
  Fly   576 SDDNDSGGMQTVIKSEEVSQQQQQQQGQSYVLPPFLH 612

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
alNP_722629.1 Homeobox 89..141 CDD:278475 38/51 (75%)
OAR 374..391 CDD:281777
repoNP_477026.1 Homeobox 313..360 CDD:278475 33/46 (72%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45451007
Domainoid 1 1.000 55 1.000 Domainoid score I4097
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000011
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24329
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
54.940

Return to query results.
Submit another query.