DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment al and Rhox10

DIOPT Version :10

Sequence 1:NP_722629.1 Gene:al / 33208 FlyBaseID:FBgn0000061 Length:408 Species:Drosophila melanogaster
Sequence 2:NP_001020021.1 Gene:Rhox10 / 434769 MGIID:3580249 Length:196 Species:Mus musculus


Alignment Length:88 Identity:29/88 - (32%)
Similarity:50/88 - (56%) Gaps:5/88 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly    63 TNSPVSDGNSDCEADEYAPKR-----KQRRYRTTFTSFQLEELEKAFSRTHYPDVFTREELAMKI 122
            |.:..|:...:.:|....|::     .:|.....:|:.|:.||||||..|.|||...|:.||..|
Mouse    60 TQTYSSETRKETQARPKEPEKAAGAVSRRSNSKKYTNAQMCELEKAFQETQYPDAHQRKALAKLI 124

  Fly   123 GLTEARIQVWFQNRRAKWRKQEK 145
            .:.|.:::.||:.:|||:|:::|
Mouse   125 DVDECKVKAWFKYKRAKYRRKQK 147

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
alNP_722629.1 Homeodomain 86..142 CDD:459649 23/55 (42%)
OAR 374..391 CDD:461067
Rhox10NP_001020021.1 Homeodomain 94..144 CDD:459649 22/49 (45%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.