DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment al and si:dkey-43p13.5

DIOPT Version :9

Sequence 1:NP_722629.1 Gene:al / 33208 FlyBaseID:FBgn0000061 Length:408 Species:Drosophila melanogaster
Sequence 2:XP_002661267.2 Gene:si:dkey-43p13.5 / 407678 ZFINID:ZDB-GENE-131121-510 Length:315 Species:Danio rerio


Alignment Length:328 Identity:88/328 - (26%)
Similarity:118/328 - (35%) Gaps:155/328 - (47%)


- Green bases have known domain annotations that are detailed below.


  Fly    68 SDGNSDCEADEYAPKRKQRRYRTTFTSFQLEELEKAFSRTHYPDVFTREELAMKIGLTEARIQVW 132
            |.|:.....||..|. ||||.|..::|:|||||||.|..|||||:|.||.||:::.|.|||:|||
Zfish   125 SSGHPADNIDEPRPV-KQRRARANYSSWQLEELEKTFQSTHYPDIFMREALALRLDLIEARVQVW 188

  Fly   133 FQNRRAKWRKQEKVGPQSHPYNPYLPGGAATMQTVVGAALPPNPFTHLGFQL-RKPFDAQHAANL 196
            |||||||.|:|.|:..|:                              |.|. ::..|.:|    
Zfish   189 FQNRRAKMRRQLKLQIQT------------------------------GEQCSQRDTDTRH---- 219

  Fly   197 AAFRYPHLSAAPMIPSGYFNQFQRAPPHMLPHGMAGMYSPSSSFQSLLANMTAVPRGTPLGKPPA 261
                                                   |.||                      
Zfish   220 ---------------------------------------PESS---------------------- 223

  Fly   262 LLVGSPDLHSPNHMLASPPTSPASGHASQHQQHPTAHPPPPQAPPQMPVGVQPAQLSPQHLVGIA 326
              :.:|:||:     .||  ||. ...:|.:.:| |||.|..:..|.||                
Zfish   224 --ISNPELHN-----NSP--SPC-WDRNQDRTNP-AHPKPSPSAIQSPV---------------- 261

  Fly   327 LTQQASSLSPTQTSPVALTLSHSPQRQLPPPSHQAPPPPPRAATPPEDRRTSSIAALRLKAREHE 391
                 :.|...|..|                  :||        .|||.|:.|||.||.|||::|
Zfish   262 -----TDLLQDQQDP------------------EAP--------GPEDLRSCSIAKLRAKARDYE 295

  Fly   392 LKL 394
            .::
Zfish   296 AEI 298

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
alNP_722629.1 Homeobox 89..141 CDD:278475 34/51 (67%)
OAR 374..391 CDD:281777 10/16 (63%)
si:dkey-43p13.5XP_002661267.2 Homeobox 145..197 CDD:278475 34/51 (67%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR24329
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
33.010

Return to query results.
Submit another query.