Sequence 1: | NP_722629.1 | Gene: | al / 33208 | FlyBaseID: | FBgn0000061 | Length: | 408 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_005160.2 | Gene: | PHOX2A / 401 | HGNCID: | 691 | Length: | 284 | Species: | Homo sapiens |
Alignment Length: | 316 | Identity: | 97/316 - (30%) |
---|---|---|---|
Similarity: | 119/316 - (37%) | Gaps: | 120/316 - (37%) |
- Green bases have known domain annotations that are detailed below.
Fly 45 SMSVSGGAPSGASGASGGTN-SPVSD------------GNSDC---------------------- 74
Fly 75 EADEYAPKRKQRRYRTTFTSFQLEELEKAFSRTHYPDVFTREELAMKIGLTEARIQVWFQNRRAK 139
Fly 140 WRKQEKVGPQSHPYNPYLPGGAATMQTVVGAA------------------------------LPP 174
Fly 175 NPFTHLGFQLRKPFDAQHAANLAAFRYPHLSAAPMIPSGYFNQFQRAPPHMLPHGMAGMYSPSSS 239
Fly 240 FQSLLANMTAVPRGTPLGKPPALLVGSPDLHSPNHMLASPPTSPASGHASQHQQHP 295 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
al | NP_722629.1 | Homeobox | 89..141 | CDD:278475 | 40/51 (78%) |
OAR | 374..391 | CDD:281777 | |||
PHOX2A | NP_005160.2 | Homeobox | 94..147 | CDD:365835 | 40/52 (77%) |
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 145..284 | 39/186 (21%) | |||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 0 | 0.000 | Not matched by this tool. | |||
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 1 | 1.000 | - | - | FOG0000011 | |
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 1 | 0.910 | - | - | ||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
User_Submission | 0 | 0.000 | Not matched by this tool. | |||
2 | 1.910 |