DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment al and Rhox12

DIOPT Version :9

Sequence 1:NP_722629.1 Gene:al / 33208 FlyBaseID:FBgn0000061 Length:408 Species:Drosophila melanogaster
Sequence 2:NP_001020254.1 Gene:Rhox12 / 382282 MGIID:2685994 Length:186 Species:Mus musculus


Alignment Length:144 Identity:39/144 - (27%)
Similarity:65/144 - (45%) Gaps:22/144 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 SEEIKLEELPQEAKLAHPDAVVLVDRAPGSSAASAGAALTVSMSVSGGAPSGASGASGGTNSPVS 68
            |:::|.:.:|.:     .|.|:.|...               .::.........|:..|:..|..
Mouse    47 SDKLKCQGIPDD-----KDDVIYVGEL---------------KNIGNDIKDECHGSHQGSGDPQP 91

  Fly    69 DGNSDCEADEYAP--KRKQRRYRTTFTSFQLEELEKAFSRTHYPDVFTREELAMKIGLTEARIQV 131
            :......|....|  :|.:.|.:..||..||.|||..|.:|.|||..||:.||..:.|.|:::|.
Mouse    92 EEKQKNSAAARVPQVRRTRPRIQLGFTPRQLNELEDFFEKTKYPDALTRKNLAKHLYLAESKVQR 156

  Fly   132 WFQNRRAKWRKQEK 145
            ||:.|||.:||:::
Mouse   157 WFKKRRAHYRKEQQ 170

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
alNP_722629.1 Homeobox 89..141 CDD:278475 24/51 (47%)
OAR 374..391 CDD:281777
Rhox12NP_001020254.1 homeodomain 107..169 CDD:238039 28/61 (46%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.