DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment al and gsb-n

DIOPT Version :9

Sequence 1:NP_722629.1 Gene:al / 33208 FlyBaseID:FBgn0000061 Length:408 Species:Drosophila melanogaster
Sequence 2:NP_523862.1 Gene:gsb-n / 38004 FlyBaseID:FBgn0001147 Length:449 Species:Drosophila melanogaster


Alignment Length:360 Identity:116/360 - (32%)
Similarity:147/360 - (40%) Gaps:92/360 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 SEEIKLEELPQEAKLAHPDAVVLVDR-APGSSAASAGAALTVSMSVSGGAPSGASGASGGTNSPV 67
            |.||: |:|.:|. .|.|.:...:.| ..||...|.          .|......:|..||.:|.:
  Fly   115 SWEIR-EKLIKEG-FADPPSTSSISRLLRGSDRGSE----------DGRKDYTINGILGGRDSDI 167

  Fly    68 SDGNSDCEADEYAP-KRKQRRYRTTFTSFQLEELEKAFSRTHYPDVFTREELAMKIGLTEARIQV 131
                ||.|::...| ||||||.|||||:.|||.||:|||||.||||:||||||....||||||||
  Fly   168 ----SDTESEPGIPLKRKQRRSRTTFTAEQLEALERAFSRTQYPDVYTREELAQTTALTEARIQV 228

  Fly   132 WFQNRRAKWRKQEKVGPQSHPYNP----------------------YLPGGAATM--------QT 166
            ||.||||:.||..  |..:...:|                      |.|.|..:|        .|
  Fly   229 WFSNRRARLRKHS--GGSNSGLSPMNSGSSNVGVGVGLSGATAPLGYGPLGVGSMAGYSPAPGTT 291

  Fly   167 VVGAALPPNPFTHLGFQLRKPFDAQHAANLAAFRYPHLSAAPMIPSGYFNQFQRAPPHMLPHGMA 231
            ..||.:  |...|  .....|.....||..||..:.|..      .|.::..|.|..|..|.|.|
  Fly   292 ATGAGM--NDGVH--HAAHAPSSHHSAATAAAAAHHHTQ------MGGYDLVQSAAQHGFPGGFA 346

  Fly   232 --GMYSPSSSFQSLLANMTAVPRGTPLGKPPALLVG--SPDLH-SPNHMLASPPT--SPASGHA- 288
              |.:...:.:....:.:|.    ....|..|..|.  ||.|| |.|:.....|:  |.|:.|| 
  Fly   347 QPGHFGSQNYYHQDYSKLTI----DDFSKLTADSVSKISPSLHLSDNYSKLEAPSNWSQAAYHAA 407

  Fly   289 -------SQHQQHPTA-------------HPPPPQ 303
                   :|||.:..|             ||.|.|
  Fly   408 ANYNAHVAQHQLNDYAAAAAHGNPASAYSHPLPTQ 442

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
alNP_722629.1 Homeobox 89..141 CDD:278475 39/51 (76%)
OAR 374..391 CDD:281777
gsb-nNP_523862.1 PAX 20..141 CDD:278709 9/27 (33%)
Homeobox 185..238 CDD:278475 39/52 (75%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45450983
Domainoid 1 1.000 55 1.000 Domainoid score I4097
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000011
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.840

Return to query results.
Submit another query.