DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment al and PHDP

DIOPT Version :9

Sequence 1:NP_722629.1 Gene:al / 33208 FlyBaseID:FBgn0000061 Length:408 Species:Drosophila melanogaster
Sequence 2:NP_523834.1 Gene:PHDP / 37788 FlyBaseID:FBgn0025334 Length:220 Species:Drosophila melanogaster


Alignment Length:82 Identity:51/82 - (62%)
Similarity:59/82 - (71%) Gaps:7/82 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly    71 NSDCEADEY-------APKRKQRRYRTTFTSFQLEELEKAFSRTHYPDVFTREELAMKIGLTEAR 128
            |:|.....|       ..|.||||.||||||.||.||||.|..|||||::||||:|.|:.|||||
  Fly    91 NTDFHLKSYGDDGLSLTDKSKQRRIRTTFTSNQLNELEKIFLETHYPDIYTREEIASKLHLTEAR 155

  Fly   129 IQVWFQNRRAKWRKQEK 145
            :||||||||||:||||:
  Fly   156 VQVWFQNRRAKFRKQER 172

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
alNP_722629.1 Homeobox 89..141 CDD:278475 39/51 (76%)
OAR 374..391 CDD:281777
PHDPNP_523834.1 Homeobox 116..168 CDD:278475 39/51 (76%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 55 1.000 Domainoid score I4097
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000011
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.910

Return to query results.
Submit another query.