DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment al and Poxn

DIOPT Version :9

Sequence 1:NP_722629.1 Gene:al / 33208 FlyBaseID:FBgn0000061 Length:408 Species:Drosophila melanogaster
Sequence 2:NP_001261016.1 Gene:Poxn / 36741 FlyBaseID:FBgn0003130 Length:425 Species:Drosophila melanogaster


Alignment Length:258 Identity:60/258 - (23%)
Similarity:84/258 - (32%) Gaps:78/258 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly   191 QHAANLAAFRYPHLSAAPMIPS-GYFNQFQRAPPHMLPHGMAGMYSPSSSFQSLLANMTAVPRGT 254
            |:||..||........|...|| ||..|   |||   |.......:|:           |.|...
  Fly   144 QNAAAAAAAAAAAAHQAGSGPSNGYGGQ---APP---PPVTVAPPTPA-----------ATPSIA 191

  Fly   255 PLGKPPALLVGSPDLHSPNHMLASPPTSPASGHASQHQQHPT----------------------- 296
            ...|||||::.|.. ..|  :..:|...|:.||...|..:|.                       
  Fly   192 RYAKPPALMMNSAG-EMP--IKPAPKMPPSMGHGHSHGLNPNVSGLDLSYSALHKHWLWNPSLLY 253

  Fly   297 ---AHPPP----------PQAPPQMPVGVQPAQLSPQHLVGIALTQQASSLSPT----------- 337
               ||...          |.|...:|..:..|..|....:| ..|:..||:..:           
  Fly   254 YTQAHIQAQAAASGGQFLPYAGGYLPHAMAAAAASSTSALG-GFTKSESSIDLSTPGAAGDALSD 317

  Fly   338 ----QTSPVALTLSHSPQRQLPPPSHQAPPPPPRAATPPEDRRTS-SIAALRLKAREHELKLE 395
                ::||.||:|:.|....   .:..||...|.:......:|.. ||..| ||..|..|:|:
  Fly   318 CDSGKSSPAALSLTASGGGN---GAGSAPEASPGSTLSHSRKRNPYSIEEL-LKKPEKRLRLD 376

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
alNP_722629.1 Homeobox 89..141 CDD:278475
OAR 374..391 CDD:281777 7/17 (41%)
PoxnNP_001261016.1 HTH 5..133 CDD:304362
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45451022
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.