DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment al and CG32532

DIOPT Version :9

Sequence 1:NP_722629.1 Gene:al / 33208 FlyBaseID:FBgn0000061 Length:408 Species:Drosophila melanogaster
Sequence 2:NP_608318.5 Gene:CG32532 / 32943 FlyBaseID:FBgn0052532 Length:688 Species:Drosophila melanogaster


Alignment Length:226 Identity:82/226 - (36%)
Similarity:104/226 - (46%) Gaps:71/226 - (31%)


- Green bases have known domain annotations that are detailed below.


  Fly    54 SGASGASGGTNSPVSD--------GNSDCEADEYAPKRKQRRYRTTFTSFQLEELEKAFSRTHYP 110
            ||.|..|.|..||.|.        |::...|.  .|...:||:|||||..||.|||.||:::|||
  Fly   473 SGLSTVSAGITSPGSGLSSLSQHAGHTPTTAS--CPTPARRRHRTTFTQEQLAELEAAFAKSHYP 535

  Fly   111 DVFTREELAMKIGLTEARIQVWFQNRRAKWRKQEK-----VGPQ-----------------SHPY 153
            |::.|||||....|.||||||||||||||:|||||     :.|.                 |..|
  Fly   536 DIYCREELARTTKLNEARIQVWFQNRRAKYRKQEKQLQKALAPSVIPSCNGMMRNIQGYSVSRGY 600

  Fly   154 NPYLPGGAATMQTV------VGAALPP---NPF-----THLG-----------FQLRKPFDAQHA 193
            .||....  ||...      :||:..|   .||     |::|           |....|.|..:.
  Fly   601 QPYPHHN--TMNRYPQDLFQMGASSYPGMTQPFSMAHSTNMGSVGVRQDSMGEFHGMSPEDEWYN 663

  Fly   194 ANLAAFR-----YPHLSAAPMIPSGYFNQFQ 219
            .:|:|.|     :|:|| |||:      |:|
  Fly   664 KSLSALRMNSSHHPNLS-APML------QYQ 687

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
alNP_722629.1 Homeobox 89..141 CDD:278475 36/51 (71%)
OAR 374..391 CDD:281777
CG32532NP_608318.5 Homeobox 513..566 CDD:278475 36/52 (69%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45450867
Domainoid 1 1.000 55 1.000 Domainoid score I4097
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000011
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24329
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
54.940

Return to query results.
Submit another query.