DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment al and CG11294

DIOPT Version :10

Sequence 1:NP_722629.1 Gene:al / 33208 FlyBaseID:FBgn0000061 Length:408 Species:Drosophila melanogaster
Sequence 2:NP_572500.1 Gene:CG11294 / 31807 FlyBaseID:FBgn0030058 Length:261 Species:Drosophila melanogaster


Alignment Length:104 Identity:54/104 - (51%)
Similarity:69/104 - (66%) Gaps:10/104 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly    82 KRKQRRYRTTFTSFQLEELEKAFSRTHYPDVFTREELAMKIGLTEARIQVWFQNRRAKWRKQEKV 146
            :|:|||.|||||..||:|||..|.:|||||||.|||:|::|.|:|||:||||||||||||||.::
  Fly    21 RRRQRRNRTTFTPQQLQELEALFQKTHYPDVFLREEVALRISLSEARVQVWFQNRRAKWRKQARL 85

  Fly   147 GPQSHPYN---------PYLPGGAATMQTVVGA-ALPPN 175
            ......:.         |.:.|||....:..|| |.||:
  Fly    86 QLLQDAWRMRCLSLGTPPVMGGGAVQGGSGNGATARPPS 124

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
alNP_722629.1 Homeodomain 86..142 CDD:459649 40/55 (73%)
OAR 374..391 CDD:461067
CG11294NP_572500.1 Homeodomain 29..81 CDD:459649 37/51 (73%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.