powered by:
Protein Alignment al and oc
DIOPT Version :9
Sequence 1: | NP_722629.1 |
Gene: | al / 33208 |
FlyBaseID: | FBgn0000061 |
Length: | 408 |
Species: | Drosophila melanogaster |
Sequence 2: | NP_001356934.1 |
Gene: | oc / 31802 |
FlyBaseID: | FBgn0004102 |
Length: | 664 |
Species: | Drosophila melanogaster |
Alignment Length: | 69 |
Identity: | 42/69 - (60%) |
Similarity: | 53/69 - (76%) |
Gaps: | 0/69 - (0%) |
- Green bases have known domain annotations that are detailed below.
Fly 83 RKQRRYRTTFTSFQLEELEKAFSRTHYPDVFTREELAMKIGLTEARIQVWFQNRRAKWRKQEKVG 147
|||||.|||||..||:.||..|.:|.|||:|.|||:|:||.|.|:|:||||:|||||.|:|.:..
Fly 65 RKQRRERTTFTRAQLDVLEALFGKTRYPDIFMREEVALKINLPESRVQVWFKNRRAKCRQQLQQQ 129
Fly 148 PQSH 151
.||:
Fly 130 QQSN 133
|
Known Domains:
Indicated by green bases in alignment.
Gene | Sequence | Domain | Region |
External ID | Identity |
al | NP_722629.1 |
Homeobox |
89..141 |
CDD:278475 |
33/51 (65%) |
OAR |
374..391 |
CDD:281777 |
|
oc | NP_001356934.1 |
Homeobox |
71..123 |
CDD:333795 |
33/51 (65%) |
Blue background indicates that the domain is not in
the aligned region.
|
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Compara |
1 |
0.930 |
- |
- |
|
C45451016 |
Domainoid |
1 |
1.000 |
55 |
1.000 |
Domainoid score |
I4097 |
eggNOG |
0 | 0.000 |
Not matched by this tool. |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
Isobase |
0 | 0.000 |
Not matched by this tool. |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoDB |
0 | 0.000 |
Not matched by this tool. |
OrthoFinder |
1 |
1.000 |
- |
- |
|
FOG0000011 |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
orthoMCL |
0 | 0.000 |
Not matched by this tool. |
Panther |
0 | 0.000 |
Not matched by this tool. |
Phylome |
1 |
0.910 |
- |
- |
|
|
RoundUp |
0 | 0.000 |
Not matched by this tool. |
SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
|
4 | 3.840 |
|
Return to query results.
Submit another query.