DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment al and oc

DIOPT Version :10

Sequence 1:NP_722629.1 Gene:al / 33208 FlyBaseID:FBgn0000061 Length:408 Species:Drosophila melanogaster
Sequence 2:NP_001356934.1 Gene:oc / 31802 FlyBaseID:FBgn0004102 Length:664 Species:Drosophila melanogaster


Alignment Length:69 Identity:42/69 - (60%)
Similarity:53/69 - (76%) Gaps:0/69 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly    83 RKQRRYRTTFTSFQLEELEKAFSRTHYPDVFTREELAMKIGLTEARIQVWFQNRRAKWRKQEKVG 147
            |||||.|||||..||:.||..|.:|.|||:|.|||:|:||.|.|:|:||||:|||||.|:|.:..
  Fly    65 RKQRRERTTFTRAQLDVLEALFGKTRYPDIFMREEVALKINLPESRVQVWFKNRRAKCRQQLQQQ 129

  Fly   148 PQSH 151
            .||:
  Fly   130 QQSN 133

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
alNP_722629.1 Homeodomain 86..142 CDD:459649 35/55 (64%)
OAR 374..391 CDD:461067
ocNP_001356934.1 Homeodomain 68..123 CDD:459649 35/54 (65%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.