DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment al and Vsx1

DIOPT Version :9

Sequence 1:NP_722629.1 Gene:al / 33208 FlyBaseID:FBgn0000061 Length:408 Species:Drosophila melanogaster
Sequence 2:NP_001284898.1 Gene:Vsx1 / 31470 FlyBaseID:FBgn0263511 Length:837 Species:Drosophila melanogaster


Alignment Length:368 Identity:113/368 - (30%)
Similarity:143/368 - (38%) Gaps:76/368 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly    19 AHPDAVVLVDRAPGSSAASAGA----ALTVSMSVSGGAPSGASGASGGTNSPVSDGNSDCEADEY 79
            ||..|.|....|..:.||.|.|    |...:...:||.|:....|.|| :..|..|.:.....: 
  Fly   329 AHAHAHVHAHAAHAAHAAHAHAHHAEAFLGAAGGAGGNPNSLLAAHGG-DVLVGPGGTGPGGKK- 391

  Fly    80 APKRKQRRYRTTFTSFQLEELEKAFSRTHYPDVFTREELAMKIGLTEARIQVWFQNRRAKWRKQE 144
              |.|:|..||.|||.|||||||||...|||||..||.|:||.||.|.|||||:|||||||||.|
  Fly   392 --KNKRRHGRTIFTSSQLEELEKAFKEAHYPDVSARELLSMKTGLAEDRIQVWYQNRRAKWRKTE 454

  Fly   145 KVGPQSHPYNPYLPGGAATMQTVVGAALPPNPFTHLGFQLRKPFDAQHAANLAAFRYPHLSAAPM 209
            |....|.....|...||....::      |.|.|.:.....   |...|..|.......|.||.:
  Fly   455 KCWGHSTKMAEYGLYGAMVRHSL------PLPETIIKSAKE---DESVAPWLLGMHKKSLEAAEL 510

  Fly   210 IPSGYFNQFQRAPPHMLPHGMAGMYSPSSSFQSLLANMTAVPRGTPLGKPPALLVGSPDLHSPNH 274
            :.|   ::..|..|  ........||..|:..|.:::. ::.|         ||..:|       
  Fly   511 LKS---DESDRETP--TSDDTNTSYSAGSTHNSPISSF-SISR---------LLFDAP------- 553

  Fly   275 MLASPPTSPASG------HASQHQQHPTAH-PPPPQAPPQMPVGVQPAQLSPQ---------HLV 323
                ||.:.::|      |...|:.|..|| ....||...|.:..|..|...|         |..
  Fly   554 ----PPAAGSAGGKGHHHHHHHHKGHHHAHVHAQAQAHAHMLLHHQQQQQQQQQQQQHHHHLHAA 614

  Fly   324 GIALTQQ-------------ASSLSPTQTSPVALTLSHSPQRQ 353
            ..:|.||             .|......|.|.|    |.|..|
  Fly   615 ENSLQQQQVAGTGSGSGSGSGSGTGAGSTGPPA----HHPYNQ 653

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
alNP_722629.1 Homeobox 89..141 CDD:278475 38/51 (75%)
OAR 374..391 CDD:281777
Vsx1NP_001284898.1 Homeobox 399..451 CDD:278475 38/51 (75%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45450965
Domainoid 1 1.000 55 1.000 Domainoid score I4097
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.840

Return to query results.
Submit another query.