DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment al and pax7a

DIOPT Version :9

Sequence 1:NP_722629.1 Gene:al / 33208 FlyBaseID:FBgn0000061 Length:408 Species:Drosophila melanogaster
Sequence 2:NP_571400.1 Gene:pax7a / 30587 ZFINID:ZDB-GENE-990415-201 Length:507 Species:Danio rerio


Alignment Length:360 Identity:114/360 - (31%)
Similarity:154/360 - (42%) Gaps:68/360 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly    55 GASGASGGTNSPVSDGNSDCEADEYAP-KRKQRRYRTTFTSFQLEELEKAFSRTHYPDVFTREEL 118
            |..|..|..    :|..||.|::...| ||||||.|||||:.|||||||||.||||||::|||||
Zfish   193 GILGDKGNR----TDEGSDVESEPDLPLKRKQRRSRTTFTAEQLEELEKAFERTHYPDIYTREEL 253

  Fly   119 AMKIGLTEARIQVWFQNRRAKWRKQEKVGPQSHPYNPYLPGGAATMQTVVGAALPPNPFTHL-GF 182
            |.:..|||||:||||.||||:||||.... |...:|..||||           .||.....| .:
Zfish   254 AQRTKLTEARVQVWFSNRRARWRKQAGAN-QLAAFNHLLPGG-----------FPPTGMPTLPTY 306

  Fly   183 QLRKPFDAQHAANLAAFRYPHLSAAPMIPSGYFNQFQRAPPHMLPHGMAGMYSPSSSFQSLLANM 247
            ||.:.            .||..:.: ...|...::.|..||..:..|  |:.:.|.|...|.:|.
Zfish   307 QLPES------------TYPSTTLS-QDGSSTLHRPQPLPPSSMHQG--GLSADSGSAYGLSSNR 356

  Fly   248 -TAVPRGTPLGKPPALLVGSPDLHSPNHMLASPPTSPASGHASQHQQHPTAHPPPPQAPPQMPVG 311
             |..........|.|         |.|||  :|.::..|........:|:|.|..||        
Zfish   357 HTFSSYSETFMSPTA---------SSNHM--NPVSNGLSPQVMSILSNPSAVPSQPQ-------- 402

  Fly   312 VQPAQLSPQHLVGIALTQQASSLSPTQTSPVALTLSHSPQRQLPPPSHQAPP---PPPRA----- 368
             ....:||.| .|:..:...|:....::.|:....|.:..:...||::.|..   .|..|     
Zfish   403 -HDFSISPLH-GGLEASNPISASCSQRSDPIKSVDSLASTQSYCPPTYSATSYSVDPVTAGYQYS 465

  Fly   369 -----ATPPEDRRTSSIAALRLKAREHELKLELLR 398
                 |.....:..|.....|:|..:|...|.||:
Zfish   466 QYGQTAVDYLAKNVSLSTQRRMKLGDHSAVLGLLQ 500

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
alNP_722629.1 Homeobox 89..141 CDD:278475 39/51 (76%)
OAR 374..391 CDD:281777 3/16 (19%)
pax7aNP_571400.1 PAX 34..166 CDD:238076
Homeobox 223..276 CDD:278475 39/52 (75%)
Pax7 343..386 CDD:289156 13/53 (25%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000011
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.