DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment al and pax3a

DIOPT Version :9

Sequence 1:NP_722629.1 Gene:al / 33208 FlyBaseID:FBgn0000061 Length:408 Species:Drosophila melanogaster
Sequence 2:NP_571352.1 Gene:pax3a / 30532 ZFINID:ZDB-GENE-980526-52 Length:509 Species:Danio rerio


Alignment Length:352 Identity:106/352 - (30%)
Similarity:134/352 - (38%) Gaps:118/352 - (33%)


- Green bases have known domain annotations that are detailed below.


  Fly    62 GTNSPVSDGNSDCEADEYAP-KRKQRRYRTTFTSFQLEELEKAFSRTHYPDVFTREELAMKIGLT 125
            |..|..||..||.:::...| ||||||.|||||:.||||||:||.||||||::||||||.:..||
Zfish   196 GDRSSHSDEGSDVDSEPGLPLKRKQRRSRTTFTAEQLEELERAFERTHYPDIYTREELAQRAKLT 260

  Fly   126 EARIQVWFQNRRAKWRKQEKVGPQSHPYNPYLPGGAATMQTVVGAALPPNPFTHLGFQLRKPFDA 190
            |||:||||.||||:||||.... |...:|..:|||           .||:..:.|     :|:  
Zfish   261 EARVQVWFSNRRARWRKQAGAN-QLMAFNHLIPGG-----------FPPSAMSSL-----QPY-- 306

  Fly   191 QHAANLAAFRYPHLSAA-------------PMIP------------------------------S 212
                .||...||..|.:             |:.|                              |
Zfish   307 ----QLADSPYPPSSISQVSEQPSTVHRPQPLPPTSVHQSGLGSGPGAQEGSSAYCLSSGRHGFS 367

  Fly   213 GYFNQFQRAPPHM----------LPHGMAGMYSPSSSFQSLLANMTAVPRGTPLGKPPALLVGSP 267
            ||.:.:..||.|.          ||..:.|:.:|.           |||                
Zfish   368 GYSDGYVAAPGHANPVNPSISNGLPSQVMGLLNPG-----------AVP---------------- 405

  Fly   268 DLHSPNHMLASPPTS---------PASGHASQHQQHPTAHPPPPQAPPQM---PVGVQPAQLSPQ 320
              |.|....|..|.:         |||.|:||..:.....|..|..|...   |........|..
Zfish   406 --HQPQSDFALSPLTGGLEPSTGMPASCHSSQRLEALPGLPSMPALPSSQSYCPSSYSSPGYSVD 468

  Fly   321 HLVGIALTQQASSLSPTQTSPVALTLS 347
            |:.....:|...|...|.|......||
Zfish   469 HVASYQYSQYGQSKVNTSTVTTVERLS 495

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
alNP_722629.1 Homeobox 89..141 CDD:278475 38/51 (75%)
OAR 374..391 CDD:281777
pax3aNP_571352.1 PAX 34..159 CDD:128645
Homeobox 223..276 CDD:278475 38/52 (73%)
Pax7 350..394 CDD:289156 8/43 (19%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000011
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
32.910

Return to query results.
Submit another query.