DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment al and Alx4

DIOPT Version :9

Sequence 1:NP_722629.1 Gene:al / 33208 FlyBaseID:FBgn0000061 Length:408 Species:Drosophila melanogaster
Sequence 2:NP_001100023.1 Gene:Alx4 / 296511 RGDID:1310201 Length:399 Species:Rattus norvegicus


Alignment Length:400 Identity:112/400 - (28%)
Similarity:149/400 - (37%) Gaps:149/400 - (37%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 IKLEE----------LP---QEAKLAHPDAVVLVDRAPGSSAASAGAALTVSMSVSGGAPSGASG 58
            :||:|          :|   :|:.|..|:.      .|.|.......:...........|...:|
  Rat   125 LKLQEGSGGHNAALQVPCYAKESNLGEPEL------PPDSEPVGMDNSYLSVKETGAKGPQDRAG 183

  Fly    59 ASGGTNSPVSDGNSDCEADEYAPKRKQRRYRTTFTSFQLEELEKAFSRTHYPDVFTREELAMKIG 123
            |.  ..||:.      :.|..:.|.|:||.||||||:|||||||.|.:||||||:.||:|||:..
  Rat   184 AE--IPSPLE------KTDSESSKGKKRRNRTTFTSYQLEELEKVFQKTHYPDVYAREQLAMRTD 240

  Fly   124 LTEARIQVWFQNRRAKWRKQEKVGPQSHPYNPYLPGGAATMQTVVGAALPPNPFTHLGFQLRKPF 188
            |||||:|||||||||||||:|:.|               .||                 |:|..|
  Rat   241 LTEARVQVWFQNRRAKWRKRERFG---------------QMQ-----------------QVRTHF 273

  Fly   189 DAQHAANLAAFRYPHLSAAPMIPSGYFNQFQRAPPHMLPHGMAGMYSPSSSFQSLLANMTAVPRG 253
            .       .|:..|.|:.|.       |..|...|..:  |..|..||                 
  Rat   274 S-------TAYELPLLTRAE-------NYAQIQNPSWI--GNNGAASP----------------- 305

  Fly   254 TPLGKPPALLVGSPDLHSPNHMLASPPTSPASGHASQHQQHPTAHPPPPQAPPQ---MPVGVQPA 315
                 .||.:|               |..|.....|.|     ||||...|...   :.|....:
  Rat   306 -----VPACVV---------------PCDPVPACMSPH-----AHPPGSGASSVSDFLSVSGAGS 345

  Fly   316 QLSPQHLVGIALTQQASSLSPTQTSPVALTLSHSPQRQLPPPSHQAPPPPPRAATPPEDRRTSSI 380
            .:...|:..:.   .|:.:||...   ...::..|                       ||:||||
  Rat   346 HVGQTHMGSLF---GAAGISPGLN---GYEMNGEP-----------------------DRKTSSI 381

  Fly   381 AALRLKAREH 390
            ||||:||:||
  Rat   382 AALRMKAKEH 391

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
alNP_722629.1 Homeobox 89..141 CDD:278475 40/51 (78%)
OAR 374..391 CDD:281777 13/16 (81%)
Alx4NP_001100023.1 Homeobox 206..258 CDD:278475 40/51 (78%)
OAR 375..392 CDD:281777 13/16 (81%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 144 1.000 Inparanoid score I4344
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D454642at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR24329
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
55.070

Return to query results.
Submit another query.