DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment al and Pax2

DIOPT Version :9

Sequence 1:NP_722629.1 Gene:al / 33208 FlyBaseID:FBgn0000061 Length:408 Species:Drosophila melanogaster
Sequence 2:XP_006231505.2 Gene:Pax2 / 293992 RGDID:1305568 Length:432 Species:Rattus norvegicus


Alignment Length:367 Identity:85/367 - (23%)
Similarity:119/367 - (32%) Gaps:147/367 - (40%)


- Green bases have known domain annotations that are detailed below.


  Fly    21 PDAVVLVDRAPGSSAASAGAALTV---------SMSVSG--GAPSG----------------ASG 58
            ||.......|||.:...:.|:..|         |.|::|  |.|..                |..
  Rat   151 PDGAGTGVTAPGHTIVPSTASPPVSSASNDPVGSYSINGILGIPRSNGEKRKREEVEVYTDPAHI 215

  Fly    59 ASGG-----------TNSPVSDGNSDCEADEYAPKRKQRRYRTTFTSFQLEELEKAFSRTHYPDV 112
            ..||           :...|.:|:|....|..   ||..| ..|||..|||.|::.|.|..||||
  Rat   216 RGGGGLHLVWTLRDVSEGSVPNGDSQSGVDSL---RKHLR-ADTFTQQQLEALDRVFERPSYPDV 276

  Fly   113 FTREELAMKIGLTEARIQVWFQNRRAKWRKQEKVGPQSHPYN-PYLPGGAATMQTVVGAALPPNP 176
            |...|..                      |.|    |.:.|: |.|..|...:::.:.|:..|  
  Rat   277 FQASEHI----------------------KSE----QGNEYSLPALTPGLDEVKSSLSASTNP-- 313

  Fly   177 FTHLGFQLRKPFDAQHAANLAAFR-YPHLSAAPMIPS---GYFNQFQRAPPHMLPHGMAGMYSPS 237
              .||            :|::..: ||.::...|..:   ||       |||:.|.|. |.| |:
  Rat   314 --ELG------------SNVSGTQTYPVVTGRDMASTTLPGY-------PPHVPPTGQ-GSY-PT 355

  Fly   238 SSFQSLLANMTAVPRGTPLGKPPALLVGSPDLHSPNHMLASPPTSPASGHASQHQQH-------- 294
            |:    ||.|.                               |.|..||:...|.|:        
  Rat   356 ST----LAGMV-------------------------------PGSEFSGNPYSHPQYTAYNEAWR 385

  Fly   295 ---PTAHPPPPQAPPQMPVGVQPAQLSPQHLVGIALTQQASS 333
               |....|||.||| :|  :.|..::.....|..:..||.|
  Rat   386 FSNPALLMPPPGAPP-LP--LLPLPMTATSYRGDHIKLQADS 424

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
alNP_722629.1 Homeobox 89..141 CDD:278475 15/51 (29%)
OAR 374..391 CDD:281777
Pax2XP_006231505.2 None
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.