DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment al and sebox

DIOPT Version :9

Sequence 1:NP_722629.1 Gene:al / 33208 FlyBaseID:FBgn0000061 Length:408 Species:Drosophila melanogaster
Sequence 2:NP_001306981.1 Gene:sebox / 282666 ZFINID:ZDB-GENE-021206-4 Length:293 Species:Danio rerio


Alignment Length:307 Identity:87/307 - (28%)
Similarity:109/307 - (35%) Gaps:92/307 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly    64 NSPVSDGNSDCEADEYAPKRKQRRYRTTFTSFQLEELEKAFSRTHYPDVFTREELAMKIGLTEAR 128
            :||..|.....|.       :::|.||.|:..||.|||:||..|.|||:..||.||....|.|::
Zfish    44 SSPELDRTGHVEG-------QRKRKRTIFSRAQLSELERAFMITPYPDITLRERLAALTLLPESK 101

  Fly   129 IQVWFQNRRAKWRKQEKVGPQSHPYNPYLPGGAATMQTVVGAALPPNPFTHLGFQLRKPFDAQHA 193
            ||||||||||:..|.:|                  :.|.|....|....|         |.|.| 
Zfish   102 IQVWFQNRRARSMKSKK------------------LITPVSRRSPAKDCT---------FPATH- 138

  Fly   194 ANLAAFRYPHLSAAPMIPSGYFNQFQRAPPHMLPHGMAGMYSPSSSFQSLLANMTAVPRGTPLGK 258
                    |.|:         ..|...|...:..|            |..|......|  .|..:
Zfish   139 --------PDLN---------LEQSPEANKSLRHH------------QQSLIRQALNP--WPQNR 172

  Fly   259 PPALLVGSPDLHS----PNHMLASPPTSPASGHASQHQQHPTAHPPPPQAPPQMPVGVQPAQLSP 319
            ||.    ||||..    .|....:|..|..|...|:..|||.    |.|:.....:....|.  |
Zfish   173 PPI----SPDLPEILQWANRNSETPGDSSFSSCPSERIQHPF----PNQSSSVWQMNCFAAH--P 227

  Fly   320 QHLVGIALTQQA--SSLSPTQTSPV-------AL---TLSHSPQRQL 354
            :.|.....|.||  ||:|..|..|.       ||   .|:|.||..|
Zfish   228 EGLKSYCTTSQALYSSVSVDQMIPAHPSSLEEALQRQALTHYPQTSL 274

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
alNP_722629.1 Homeobox 89..141 CDD:278475 30/51 (59%)
OAR 374..391 CDD:281777
seboxNP_001306981.1 COG5576 13..159 CDD:227863 50/178 (28%)
Homeobox 61..112 CDD:278475 29/50 (58%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 117..144 10/71 (14%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR24329
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.