DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment al and Pax6

DIOPT Version :9

Sequence 1:NP_722629.1 Gene:al / 33208 FlyBaseID:FBgn0000061 Length:408 Species:Drosophila melanogaster
Sequence 2:XP_006234695.1 Gene:Pax6 / 25509 RGDID:3258 Length:436 Species:Rattus norvegicus


Alignment Length:258 Identity:88/258 - (34%)
Similarity:115/258 - (44%) Gaps:62/258 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly    58 GASGGTNSPVSDGNSDCEAD-EYAPKRKQRRYRTTFTSFQLEELEKAFSRTHYPDVFTREELAMK 121
            |....|||..|:|....||. ....|||.:|.||:||..|:|.|||.|.||||||||.||.||.|
  Rat   196 GQGENTNSISSNGEDSDEAQMRLQLKRKLQRNRTSFTQEQIEALEKEFERTHYPDVFARERLAAK 260

  Fly   122 IGLTEARIQVWFQNRRAKWRKQEKVGPQ--------SH-PYN-------------PYLPGGAATM 164
            |.|.||||||||.|||||||::||:..|        || |.:             |..|..:.|.
  Rat   261 IDLPEARIQVWFSNRRAKWRREEKLRNQRRQASNTPSHIPISSSFSTSVYQPIPQPTTPVSSFTS 325

  Fly   165 QTVVG----------AALPPNP-FTHL-GFQLRKPFDAQHAANLAAFRYPHLSAAPMIPSGYFNQ 217
            .:::|          :||||.| ||.. ...::.|..:|.::....     |..:|.:....::.
  Rat   326 GSMLGRTDTALTNTYSALPPMPSFTMANNLPMQPPVPSQTSSYSCM-----LPTSPSVNGRSYDT 385

  Fly   218 FQRAPPHMLPHGMAGMYSPSSSFQSLLANMTAVPRGTPLGKPPALLVGSPDLHSPNHMLASPP 280
            :  .||||..|                  |.:.|.||.......|:  ||.:..|..:..|.|
  Rat   386 Y--TPPHMQTH------------------MNSQPMGTSGTTSTGLI--SPGVSVPVQVPGSEP 426

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
alNP_722629.1 Homeobox 89..141 CDD:278475 38/51 (75%)
OAR 374..391 CDD:281777
Pax6XP_006234695.1 PAX 4..142 CDD:128645
Homeobox 228..281 CDD:395001 39/52 (75%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.