DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment al and yox1

DIOPT Version :9

Sequence 1:NP_722629.1 Gene:al / 33208 FlyBaseID:FBgn0000061 Length:408 Species:Drosophila melanogaster
Sequence 2:NP_595674.1 Gene:yox1 / 2540309 PomBaseID:SPBC21B10.13c Length:201 Species:Schizosaccharomyces pombe


Alignment Length:99 Identity:33/99 - (33%)
Similarity:51/99 - (51%) Gaps:9/99 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly    46 MSVSGGAPSGASGASGGTNSPVSDGNSDCEADEYAPKRKQRRYRTTFTSFQLEELEKAFSRTHYP 110
            ||:| .:||    .||.|...:...|.....::....:|:||.|||.....|  ||:.|.:|..|
pombe     1 MSLS-DSPS----KSGNTGKDLISNNEAKNHEDEETHQKKRRRRTTDAEATL--LEQYFLKTPKP 58

  Fly   111 DVFTREELAMKI--GLTEARIQVWFQNRRAKWRK 142
            .:..|:||:.|:  .:|...:|:||||:|...|:
pombe    59 SLIERQELSKKLKSSMTPRELQIWFQNKRQSLRR 92

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
alNP_722629.1 Homeobox 89..141 CDD:278475 20/53 (38%)
OAR 374..391 CDD:281777
yox1NP_595674.1 COG5576 1..141 CDD:227863 33/99 (33%)
homeodomain 34..94 CDD:238039 24/61 (39%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R5874
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.940

Return to query results.
Submit another query.