DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment al and Alx1

DIOPT Version :9

Sequence 1:NP_722629.1 Gene:al / 33208 FlyBaseID:FBgn0000061 Length:408 Species:Drosophila melanogaster
Sequence 2:NP_037053.1 Gene:Alx1 / 25401 RGDID:2273 Length:326 Species:Rattus norvegicus


Alignment Length:376 Identity:96/376 - (25%)
Similarity:123/376 - (32%) Gaps:196/376 - (52%)


- Green bases have known domain annotations that are detailed below.


  Fly    59 ASGGTN----SPVSDGNSDCEADEYAPK-------RKQRRYRTTFTSFQLEELEKAFSRTHYPDV 112
            |..|.|    |||.......|.||...|       .|:||:||||||.|||||||.|.:||||||
  Rat    95 AMDGCNNLRMSPVKGMPEKSELDELGDKCDSNVSSSKKRRHRTTFTSLQLEELEKVFQKTHYPDV 159

  Fly   113 FTREELAMKIGLTEARIQVWFQNRRAKWRKQEKVG------------------PQSHPY----NP 155
            :.||:||::..|||||:|||||||||||||:|:.|                  |::..|    |.
  Rat   160 YVREQLALRTELTEARVQVWFQNRRAKWRKRERYGQIQQAKSHFAATYDISVLPRTDSYPQIQNN 224

  Fly   156 YLPGGAATMQTVVGAALPPN------PFTHLGFQLRKPFDAQHAANLAAFRYPHLSAAPMIPSGY 214
            ...|..:....|....||.:      |::|                           :|...|.|
  Rat   225 LWAGNTSGGSVVTSCMLPRDASSCMTPYSH---------------------------SPRTDSSY 262

  Fly   215 --FNQFQRAPPHMLPHGMAGMYSPSSSF--QSLLANMTAVPRGTPLGKPPALLVGSPDLHSPNHM 275
              |:..|....|:          |.::|  .|||                               
  Rat   263 TGFSNHQNQFGHV----------PLNNFFTDSLL------------------------------- 286

  Fly   276 LASPPTSPASGHASQHQQHPTAHPPPPQAPPQMPVGVQPAQLSPQHLVGIALTQQASSLSPTQTS 340
                 |...:|||.:                                                  
  Rat   287 -----TGTTNGHAFE-------------------------------------------------- 296

  Fly   341 PVALTLSHSPQRQLPPPSHQAPPPPPRAATPPE-DRRTSSIAALRLKAREH 390
                                         |.|| :||:||||.||:||:||
  Rat   297 -----------------------------TKPEFERRSSSIAVLRMKAKEH 318

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
alNP_722629.1 Homeobox 89..141 CDD:278475 39/51 (76%)
OAR 374..391 CDD:281777 12/17 (71%)
Alx1NP_037053.1 Homeobox 135..188 CDD:278475 39/52 (75%)
Transactivation domain. /evidence=ECO:0000269|PubMed:12390248 192..326 40/279 (14%)
OAR 302..319 CDD:281777 12/17 (71%)
OAR. /evidence=ECO:0000255|PROSITE-ProRule:PRU00138 306..319 10/13 (77%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 144 1.000 Inparanoid score I4344
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D454642at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - otm44419
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR24329
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
55.070

Return to query results.
Submit another query.