DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment al and Drgx

DIOPT Version :9

Sequence 1:NP_722629.1 Gene:al / 33208 FlyBaseID:FBgn0000061 Length:408 Species:Drosophila melanogaster
Sequence 2:NP_665710.2 Gene:Drgx / 252880 RGDID:628616 Length:263 Species:Rattus norvegicus


Alignment Length:351 Identity:102/351 - (29%)
Similarity:123/351 - (35%) Gaps:152/351 - (43%)


- Green bases have known domain annotations that are detailed below.


  Fly    48 VSGGAPSGASGASGGTNSPVSDGNSDCEADEYAPKRKQRRYRTTFTSFQLEELEKAFSRTHYPDV 112
            :.|.||.|              .:|..:.|:...:|||||.|||||..|||.||..|::||||||
  Rat    10 LEGTAPFG--------------NHSTGDFDDGFLRRKQRRNRTTFTLQQLEALEAVFAQTHYPDV 60

  Fly   113 FTREELAMKIGLTEARIQVWFQNRRAKWRKQEKVGPQSHPYNPYLPGGAATMQTVVGAALPPNPF 177
            ||||||||||.|||||:|||||||||||||.|:......|                ||..|    
  Rat    61 FTREELAMKINLTEARVQVWFQNRRAKWRKTERGASDQEP----------------GAKEP---- 105

  Fly   178 THLGFQLRKPFDAQHAANLAAFRYPHLSAAPMIPSGYFNQFQRAPPHMLPHGMAGMYSPSSSFQS 242
                                                                             
  Rat   106 ----------------------------------------------------------------- 105

  Fly   243 LLANMTAVPRGTPLGKPPALLVGSPDLHSPNHMLASPPTSPASG--HASQHQQH--PTAHPPPPQ 303
             :|.:|         .||...:.||           ||...|.|  .|.:.||.  .|..|..|.
  Rat   106 -MAEVT---------PPPVRNINSP-----------PPGDQARGKKEALEAQQSLGRTVGPAGPF 149

  Fly   304 APPQMPVGVQPAQLSPQHLVGIALTQQASSLSPTQTSPVALTLSHSPQRQLPPPSHQAPPPPPRA 368
            .|..:|              |..|          .|:..|..|||....:..|......|.|...
  Rat   150 FPSCLP--------------GTLL----------NTATYAQALSHVASLKGGPLCSCCVPDPMGL 190

  Fly   369 ATPP----EDRRTSSIAALRLKAREH 390
            :..|    :..||:|:||||:|||||
  Rat   191 SFLPTYGCQSNRTASVAALRMKAREH 216

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
alNP_722629.1 Homeobox 89..141 CDD:278475 42/51 (82%)
OAR 374..391 CDD:281777 12/17 (71%)
DrgxNP_665710.2 Homeobox 37..90 CDD:395001 43/52 (83%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 88..135 19/152 (13%)
OAR 201..218 CDD:397759 12/16 (75%)
OAR. /evidence=ECO:0000255|PROSITE-ProRule:PRU00138 204..217 10/13 (77%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 219..263
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D454642at33208
OrthoFinder 1 1.000 - - FOG0000011
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.920

Return to query results.
Submit another query.