DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment al and ceh-54

DIOPT Version :9

Sequence 1:NP_722629.1 Gene:al / 33208 FlyBaseID:FBgn0000061 Length:408 Species:Drosophila melanogaster
Sequence 2:NP_001338798.1 Gene:ceh-54 / 188474 WormBaseID:WBGene00020485 Length:221 Species:Caenorhabditis elegans


Alignment Length:150 Identity:52/150 - (34%)
Similarity:75/150 - (50%) Gaps:27/150 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly    76 ADEYAPKRKQRRYRTTFTSFQLEELEKAFSRTHYPDVFTREELAMKIGLTEARIQVWFQNRRAKW 140
            ::.:.|.||:|. |.||.:.|::|:||.|:...|||..:||:||.||.|.|.|:|:||||||||:
 Worm    37 SNNFNPDRKKRN-RITFDANQIDEMEKVFAENQYPDTMSREKLANKIQLHEERVQIWFQNRRAKY 100

  Fly   141 RKQEKVGPQSHPYNP----YLPGGAATMQ---TVVGAALPPNPFTHLGFQLRKPFDAQHAANLAA 198
            |:::|  ...|||.|    ..|.|.....   |.:.:|..|.|                 :||:.
 Worm   101 RREQK--QTGHPYEPPSITKNPTGEKEKTQDCTTLTSASSPGP-----------------SNLSN 146

  Fly   199 FRYPHLSAAPMIPSGYFNQF 218
            .....:..||.|.:...|.|
 Worm   147 DTLVSIEMAPKIGTKSVNLF 166

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
alNP_722629.1 Homeobox 89..141 CDD:278475 29/51 (57%)
OAR 374..391 CDD:281777
ceh-54NP_001338798.1 Homeobox 49..102 CDD:365835 29/52 (56%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000011
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 1 0.960 - -
43.870

Return to query results.
Submit another query.