DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment al and unc-4

DIOPT Version :9

Sequence 1:NP_722629.1 Gene:al / 33208 FlyBaseID:FBgn0000061 Length:408 Species:Drosophila melanogaster
Sequence 2:NP_496138.1 Gene:unc-4 / 174544 WormBaseID:WBGene00006744 Length:252 Species:Caenorhabditis elegans


Alignment Length:166 Identity:63/166 - (37%)
Similarity:85/166 - (51%) Gaps:33/166 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly    25 VLVDRAPGSSAASAGAALTVSMSVSGGAPSGASGASGGTNSPVSDGN------------SDCEAD 77
            ||::.:.||....|             :.:|.|.:|...::...|.|            .|.:..
 Worm    31 VLLNPSDGSETYLA-------------SDNGKSTSSREQSTSPDDDNLLMNEDDGIALEDDNDTG 82

  Fly    78 EYAPKRKQRRYRTTFTSFQLEELEKAFSRTHYPDVFTREELAMKIGLTEARIQVWFQNRRAKWRK 142
            |.|.||  ||.||.|:.:||||||.||..:||||||.||.|||::.|.|:|:|||||||||||||
 Worm    83 ESAAKR--RRTRTNFSGWQLEELESAFEASHYPDVFMREALAMRLDLLESRVQVWFQNRRAKWRK 145

  Fly   143 QEKVGPQSHPYNPYLPGGAATMQTVVGAALPPNPFT 178
            :|:   ..:..:.........|:|   .|||..||:
 Worm   146 REQ---NRNGSSEIKKDDGEQMET---KALPTFPFS 175

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
alNP_722629.1 Homeobox 89..141 CDD:278475 35/51 (69%)
OAR 374..391 CDD:281777
unc-4NP_496138.1 COG5576 <79..186 CDD:227863 52/105 (50%)
Homeobox 91..144 CDD:278475 35/52 (67%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.