DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment al and ceh-17

DIOPT Version :9

Sequence 1:NP_722629.1 Gene:al / 33208 FlyBaseID:FBgn0000061 Length:408 Species:Drosophila melanogaster
Sequence 2:NP_491393.1 Gene:ceh-17 / 172059 WormBaseID:WBGene00000440 Length:237 Species:Caenorhabditis elegans


Alignment Length:106 Identity:59/106 - (55%)
Similarity:76/106 - (71%) Gaps:16/106 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly    45 SMSVSGGAPS----GASGASGGTNSPVSDGNSDCEADEYAPKRKQRRYRTTFTSFQLEELEKAFS 105
            |.:|..|.|.    ||..::||  :|::.          |.:|||||.||||||.||:|||::|.
 Worm   117 SSNVLNGLPRSSLVGALCSTGG--APLNP----------AERRKQRRIRTTFTSGQLKELERSFC 169

  Fly   106 RTHYPDVFTREELAMKIGLTEARIQVWFQNRRAKWRKQEKV 146
            .|||||::||||:||:|.|||||:||||||||||:|||||:
 Worm   170 ETHYPDIYTREEIAMRIDLTEARVQVWFQNRRAKYRKQEKI 210

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
alNP_722629.1 Homeobox 89..141 CDD:278475 39/51 (76%)
OAR 374..391 CDD:281777
ceh-17NP_491393.1 DLL_N 20..112 CDD:403572
Homeobox 153..206 CDD:395001 39/52 (75%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000011
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.