DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment al and ARX

DIOPT Version :9

Sequence 1:NP_722629.1 Gene:al / 33208 FlyBaseID:FBgn0000061 Length:408 Species:Drosophila melanogaster
Sequence 2:NP_620689.1 Gene:ARX / 170302 HGNCID:18060 Length:562 Species:Homo sapiens


Alignment Length:419 Identity:140/419 - (33%)
Similarity:182/419 - (43%) Gaps:135/419 - (32%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 EEIKLEELPQEAKLAHPDAVVLVD---RAPGSSAASAGAALTVSMSVSGGA----------PSGA 56
            ||..||:  .|.:|...||..|:.   |.|.::..:..||...:::..||.          |..|
Human   240 EEELLED--DEEELLEDDARALLKEPRRCPVAATGAVAAAAAAAVATEGGELSPKEELLLHPEDA 302

  Fly    57 SGASGGTNSPVSDGNSDCEADEYAPKRKQRRYRTTFTSFQLEELEKAFSRTHYPDVFTREELAMK 121
            .|..|..:..:|.|:   :::|...|||||||||||||:||||||:||.:||||||||||||||:
Human   303 EGKDGEDSVCLSAGS---DSEEGLLKRKQRRYRTTFTSYQLEELERAFQKTHYPDVFTREELAMR 364

  Fly   122 IGLTEARIQVWFQNRRAKWRKQEKVGPQSHPYNPYLPGGAATMQTVVGAALPPNPFTHLGFQLRK 186
            :.|||||:|||||||||||||:||.|.|:||.....||                           
Human   365 LDLTEARVQVWFQNRRAKWRKREKAGAQTHPPGLPFPG--------------------------- 402

  Fly   187 PFDAQHAANLAAFRYPHLSAAPMIPSGYFNQFQRAPPHMLPHGMAGMYSPSSSFQSLLANMTAVP 251
            |..|.|..:      |:|.|:|.            |||   |                       
Human   403 PLSATHPLS------PYLDASPF------------PPH---H----------------------- 423

  Fly   252 RGTPLGKPPALLVGSPDLHSPNHMLASPPTSPASGHASQHQQHPTAHPPPPQA--PPQ-MPVGV- 312
                    ||              |.|..|:.|:..|:   ..|:..|||..|  ||. .|:|: 
Human   424 --------PA--------------LDSAWTAAAAAAAA---AFPSLPPPPGSASLPPSGAPLGLS 463

  Fly   313 ---------QPAQLSPQHLVGIALTQQASSLSPTQTSPVALTLSHSPQRQLPPPSHQAPPPPPRA 368
                     .||.:||      |..:..|:::|..::..|..|...|...:...........|  
Human   464 TFLGAAVFRHPAFISP------AFGRLFSTMAPLTSASTAAALLRQPTPAVEGAVASGALADP-- 520

  Fly   369 ATPPEDRRTSSIAALRLKAREHELKLELL 397
            ||...|||.||||||||||:||..:|..|
Human   521 ATAAADRRASSIAALRLKAKEHAAQLTQL 549

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
alNP_722629.1 Homeobox 89..141 CDD:278475 43/51 (84%)
OAR 374..391 CDD:281777 14/16 (88%)
ARXNP_620689.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..21
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 50..81
GCG-encoded polyalanine repeat 102..111
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 118..255 6/16 (38%)
Homeobox 332..385 CDD:395001 44/52 (85%)
OAR 526..544 CDD:397759 15/17 (88%)
OAR. /evidence=ECO:0000255|PROSITE-ProRule:PRU00138 530..543 11/12 (92%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 110 1.000 Domainoid score I6307
eggNOG 1 0.900 - - E33208_3BSUU
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D454642at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - otm40292
orthoMCL 1 0.900 - - OOG6_108797
Panther 1 1.100 - - O PTHR24329
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R5874
SonicParanoid 1 1.000 - - X3639
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
109.850

Return to query results.
Submit another query.