DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment al and Gsc

DIOPT Version :10

Sequence 1:NP_722629.1 Gene:al / 33208 FlyBaseID:FBgn0000061 Length:408 Species:Drosophila melanogaster
Sequence 2:NP_034481.1 Gene:Gsc / 14836 MGIID:95841 Length:256 Species:Mus musculus


Alignment Length:63 Identity:37/63 - (58%)
Similarity:49/63 - (77%) Gaps:0/63 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly    83 RKQRRYRTTFTSFQLEELEKAFSRTHYPDVFTREELAMKIGLTEARIQVWFQNRRAKWRKQEK 145
            |::||:||.||..|||.||..|..|.||||.|||:||.|:.|.|.:::|||:|||||||:|::
Mouse   158 RRKRRHRTIFTDEQLEALENLFQETKYPDVGTREQLARKVHLREEKVEVWFKNRRAKWRRQKR 220

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
alNP_722629.1 Homeodomain 86..142 CDD:459649 34/55 (62%)
OAR 374..391 CDD:461067
GscNP_034481.1 Homeodomain 161..217 CDD:459649 34/55 (62%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 213..256 5/8 (63%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.