DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment al and LOC1281580

DIOPT Version :10

Sequence 1:NP_722629.1 Gene:al / 33208 FlyBaseID:FBgn0000061 Length:408 Species:Drosophila melanogaster
Sequence 2:XP_321511.3 Gene:LOC1281580 / 1281580 VectorBaseID:AGAMI1_009381 Length:319 Species:Anopheles gambiae


Alignment Length:70 Identity:43/70 - (61%)
Similarity:55/70 - (78%) Gaps:2/70 - (2%)


- Green bases have known domain annotations that are detailed below.


  Fly    76 ADEYAPKRKQRRYRTTFTSFQLEELEKAFSRTHYPDVFTREELAMKIGLTEARIQVWFQNRRAKW 140
            ||.:. ||| ||:||.||..|||:||..|.:||||||..||:||:|:.|.|.|::|||:||||||
Mosquito   180 ADSHI-KRK-RRHRTIFTEEQLEQLEATFDKTHYPDVLLREKLAIKVDLKEERVEVWFKNRRAKW 242

  Fly   141 RKQEK 145
            |||::
Mosquito   243 RKQKR 247

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
alNP_722629.1 Homeodomain 86..142 CDD:459649 35/55 (64%)
OAR 374..391 CDD:461067
LOC1281580XP_321511.3 Homeodomain 188..244 CDD:459649 35/55 (64%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.