DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment al and Pax3

DIOPT Version :9

Sequence 1:NP_722629.1 Gene:al / 33208 FlyBaseID:FBgn0000061 Length:408 Species:Drosophila melanogaster
Sequence 2:NP_446162.1 Gene:Pax3 / 114502 RGDID:620431 Length:484 Species:Rattus norvegicus


Alignment Length:350 Identity:110/350 - (31%)
Similarity:141/350 - (40%) Gaps:113/350 - (32%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 GISEEIKLEEL---PQEAKLAHPDAVVLVDRAPGSSAASAGAALTVSMSVSGGAPSGASGASGGT 63
            |..||..||..   ..|.|..|....:|.:||                                 
  Rat   165 GEEEEADLERKEAEESEKKAKHSIDGILSERA--------------------------------- 196

  Fly    64 NSPVSDGNSDCEADEYAP-KRKQRRYRTTFTSFQLEELEKAFSRTHYPDVFTREELAMKIGLTEA 127
            ::|.||..||.:::...| ||||||.|||||:.||||||:||.||||||::||||||.:..||||
  Rat   197 SAPQSDEGSDIDSEPDLPLKRKQRRSRTTFTAEQLEELERAFERTHYPDIYTREELAQRAKLTEA 261

  Fly   128 RIQVWFQNRRAKWRKQEKVGPQSHPYNPYLPGGAATMQTVVGAALPPNPFTHL-GFQLRKPFDAQ 191
            |:||||.||||:||||.... |...:|..:|||           .||.....| .:||.:     
  Rat   262 RVQVWFSNRRARWRKQAGAN-QLMAFNHLIPGG-----------FPPTAMPTLPTYQLSE----- 309

  Fly   192 HAANLAAFRYPHLSAAPMIPSGYFNQFQRAPP-----------------HMLPHGMAGMYSPSSS 239
                 .:::...:..|...||...::.|..||                 :.||....|..|.:.|
  Rat   310 -----TSYQPTSIPQAVSDPSSTVHRPQPLPPSTVHQSTIPSNADSSSAYCLPSTRHGFSSYTDS 369

  Fly   240 FQSLLANMTAVPRGTPLGKPPALLVG-SPDL-----------HSPNHMLA-SP------PTSPAS 285
            |        ..|.|......||:..| ||.:           |.|....| ||      ||:..|
  Rat   370 F--------VPPSGPSNPMNPAIGNGLSPQVMGLLTNHGGVPHQPQTDYALSPLTGGLEPTTTVS 426

  Fly   286 GHASQHQQH-------PTAHP--PP 301
            ...||..:|       ||:.|  ||
  Rat   427 ASCSQRLEHMKNVDSLPTSQPYCPP 451

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
alNP_722629.1 Homeobox 89..141 CDD:278475 38/51 (75%)
OAR 374..391 CDD:281777
Pax3NP_446162.1 PAX 34..159 CDD:128645
MFAP1 164..>286 CDD:336570 66/154 (43%)
Homeobox 222..276 CDD:333795 39/53 (74%)
Pax7 347..391 CDD:289156 12/51 (24%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000011
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
32.910

Return to query results.
Submit another query.