DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment al and Prrxl1

DIOPT Version :9

Sequence 1:NP_722629.1 Gene:al / 33208 FlyBaseID:FBgn0000061 Length:408 Species:Drosophila melanogaster
Sequence 2:XP_006518472.1 Gene:Prrxl1 / 107751 MGIID:2148204 Length:354 Species:Mus musculus


Alignment Length:351 Identity:99/351 - (28%)
Similarity:120/351 - (34%) Gaps:152/351 - (43%)


- Green bases have known domain annotations that are detailed below.


  Fly    48 VSGGAPSGASGASGGTNSPVSDGNSDCEADEYAPKRKQRRYRTTFTSFQLEELEKAFSRTHYPDV 112
            :.|.||.|              .:|..:.|:...:|||||.|||||..|||.||..|::||||||
Mouse   101 LEGTAPFG--------------NHSTGDFDDGFLRRKQRRNRTTFTLQQLEALEAVFAQTHYPDV 151

  Fly   113 FTREELAMKIGLTEARIQVWFQNRRAKWRKQEKVGPQSHPYNPYLPGGAATMQTVVGAALPPNPF 177
            ||||||||||.|||||:|||||||||||||.|:......|                ||..|    
Mouse   152 FTREELAMKINLTEARVQVWFQNRRAKWRKTERGASDQEP----------------GAKEP---- 196

  Fly   178 THLGFQLRKPFDAQHAANLAAFRYPHLSAAPMIPSGYFNQFQRAPPHMLPHGMAGMYSPSSSFQS 242
                                                                             
Mouse   197 ----------------------------------------------------------------- 196

  Fly   243 LLANMTAVPRGTPLGKPPALLVGSPDLHSPNHMLASPP----TSPASGHASQHQQHPTAHPPPPQ 303
             :|.:|         .||...:.||           ||    .|......:|.....|..|..|.
Mouse   197 -MAEVT---------PPPVRNINSP-----------PPGDQTRSKKEALEAQQSLGRTVGPTGPF 240

  Fly   304 APPQMPVGVQPAQLSPQHLVGIALTQQASSLSPTQTSPVALTLSHSPQRQLPPPSHQAPPPPPRA 368
            .|..:|              |..|          .|:..|..|||....:..|......|.|...
Mouse   241 FPSCLP--------------GTLL----------NTATYAQALSHVASLKGGPLCSCCVPDPMGL 281

  Fly   369 ATPP----EDRRTSSIAALRLKAREH 390
            :..|    :..||:|:||||:|||||
Mouse   282 SFLPTYGCQSNRTASVAALRMKAREH 307

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
alNP_722629.1 Homeobox 89..141 CDD:278475 42/51 (82%)
OAR 374..391 CDD:281777 12/17 (71%)
Prrxl1XP_006518472.1 Homeobox 128..181 CDD:365835 43/52 (83%)
OAR 292..309 CDD:367680 12/16 (75%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D454642at33208
OrthoFinder 1 1.000 - - FOG0000011
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.920

Return to query results.
Submit another query.