DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment al and rax2

DIOPT Version :9

Sequence 1:NP_722629.1 Gene:al / 33208 FlyBaseID:FBgn0000061 Length:408 Species:Drosophila melanogaster
Sequence 2:XP_002941436.1 Gene:rax2 / 100494721 XenbaseID:XB-GENE-494483 Length:227 Species:Xenopus tropicalis


Alignment Length:335 Identity:97/335 - (28%)
Similarity:128/335 - (38%) Gaps:139/335 - (41%)


- Green bases have known domain annotations that are detailed below.


  Fly    61 GGTNSPVSDGNSDCEADEYAPKRKQRRYRTTFTSFQLEELEKAFSRTHYPDVFTREELAMKIGLT 125
            |.|.:|   |..:.| |...||:|.||.|||||::||.|||:||.|:|||||::|||||||:.|.
 Frog    16 GSTPTP---GTPEGE-DNELPKKKHRRNRTTFTTYQLHELERAFERSHYPDVYSREELAMKVSLP 76

  Fly   126 EARIQVWFQNRRAKWRKQEKVGPQSHPY--NPYLPGGAATMQTVVGA---ALPPNPFTHLGFQLR 185
            |.|:||||||||||||:|||:...|...  :|.|....:.|.|.||.   .||..|:      |.
 Frog    77 EVRVQVWFQNRRAKWRRQEKLETSSSKLHDSPLLSFSRSPMATGVGPLSNTLPLEPW------LT 135

  Fly   186 KPFDAQHAANLAAFRYPHLSAAPMIPSGYFNQFQRAPPHMLPHGMAGMYSPSSSFQSLLANMTAV 250
            .|.                                 |.....|.|....:||.:.|         
 Frog   136 SPI---------------------------------PGTTTVHSMPAFMAPSQALQ--------- 158

  Fly   251 PRGTPLGKPPALLVGSPDLHSPNHMLASPPTSPASGHASQHQQHPTAHPPPPQAPPQMPVGVQPA 315
                                         ||         :|.|...:..||..|      :||.
 Frog   159 -----------------------------PT---------YQSHTFLNSGPPMTP------IQPL 179

  Fly   316 QLSPQHLVGIALTQQASSLSPTQTSPVALTLSHSPQRQLPPPSHQAPPPPPRAATPPEDRRTSSI 380
            ..:|...:|..:.:                   .|..::                   |:|:|||
 Frog   180 SGAPYQCMGGFMDK-------------------FPLEEM-------------------DQRSSSI 206

  Fly   381 AALRLKAREH 390
            ||||:||:||
 Frog   207 AALRMKAKEH 216

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
alNP_722629.1 Homeobox 89..141 CDD:278475 38/51 (75%)
OAR 374..391 CDD:281777 13/17 (76%)
rax2XP_002941436.1 Homeobox 40..93 CDD:365835 39/52 (75%)
OAR 200..216 CDD:367680 11/15 (73%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 147 1.000 Inparanoid score I4304
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1085093at2759
OrthoFinder 1 1.000 - - FOG0000011
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
43.970

Return to query results.
Submit another query.