DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment al and drgx

DIOPT Version :9

Sequence 1:NP_722629.1 Gene:al / 33208 FlyBaseID:FBgn0000061 Length:408 Species:Drosophila melanogaster
Sequence 2:XP_004915967.1 Gene:drgx / 100493837 XenbaseID:XB-GENE-993712 Length:263 Species:Xenopus tropicalis


Alignment Length:353 Identity:99/353 - (28%)
Similarity:127/353 - (35%) Gaps:159/353 - (45%)


- Green bases have known domain annotations that are detailed below.


  Fly    50 GGAPSGASGASGGTNSPVSDGNSDCEADEYAPKRKQRRYRTTFTSFQLEELEKAFSRTHYPDVFT 114
            |..|.||..||              |.|:...:|||||.|||||..|||.||..|::||||||||
 Frog    13 GSPPFGAHAAS--------------EFDDGFLRRKQRRNRTTFTLQQLEALEAVFAQTHYPDVFT 63

  Fly   115 REELAMKIGLTEARIQVWFQNRRAKWRKQEKVGPQSHPYNPYLPGGA---ATMQTVVGAALPPNP 176
            ||||||||.|||||:|||||||||||||.|:...:..        ||   |...|..|..|.|:.
 Frog    64 REELAMKINLTEARVQVWFQNRRAKWRKTERGSCEQE--------GAKESAPEVTTAGRNLSPSS 120

  Fly   177 FTHLGFQLRKPFDAQHAANLAAFRYPHLSAAPMIPSGYFNQFQRAPPHMLPHGMAGMYSPS---- 237
            ........::..:||                           ||...|....|.|..:.||    
 Frog   121 TVEPVRGKKETLEAQ---------------------------QRCLSHDRAVGSATSFFPSCLPG 158

  Fly   238 -----SSFQSLLANMTAVPRGTPLGKPPALLVGSPDLHSPNHMLASPPTSPASGHASQHQQHPTA 297
                 :|:...|:::.:: :|:||                                         
 Frog   159 ALLNTASYAQALSHVASL-KGSPL----------------------------------------- 181

  Fly   298 HPPPPQAPPQMPVGVQPAQLSPQHLVGIALTQQASSLSPTQTSPVALTLSHSPQRQLPPPSHQAP 362
                                                .|...:.|:.|:.       |||...|: 
 Frog   182 ------------------------------------CSCCVSDPLGLSF-------LPPYGCQS- 202

  Fly   363 PPPPRAATPPEDRRTSSIAALRLKAREH 390
                        .||:|:||||:|||||
 Frog   203 ------------HRTASVAALRMKAREH 218

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
alNP_722629.1 Homeobox 89..141 CDD:278475 42/51 (82%)
OAR 374..391 CDD:281777 12/17 (71%)
drgxXP_004915967.1 Homeobox 38..91 CDD:395001 43/52 (83%)
OAR 204..220 CDD:397759 12/15 (80%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D454642at33208
OrthoFinder 1 1.000 - - FOG0000011
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.920

Return to query results.
Submit another query.