DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment al and alx4

DIOPT Version :9

Sequence 1:NP_722629.1 Gene:al / 33208 FlyBaseID:FBgn0000061 Length:408 Species:Drosophila melanogaster
Sequence 2:XP_004913406.1 Gene:alx4 / 100493396 XenbaseID:XB-GENE-853003 Length:376 Species:Xenopus tropicalis


Alignment Length:392 Identity:112/392 - (28%)
Similarity:152/392 - (38%) Gaps:142/392 - (36%)


- Green bases have known domain annotations that are detailed below.


  Fly    14 QEAKLAHPDAVVLVDRAPGSSAASAGA---ALTVSMSVSGGAPSG--ASGASGGTNSPVSDGNSD 73
            |......|...:.|..:||.......|   |||.: |...|..||  .|..:.|..|. ..|:.|
 Frog   104 QSTPCKSPSDSLKVQDSPGDPLIPCYAKESALTPN-SDHQGMDSGYITSKETAGKGSQ-DRGSGD 166

  Fly    74 CEADE---YAPKRKQRRYRTTFTSFQLEELEKAFSRTHYPDVFTREELAMKIGLTEARIQVWFQN 135
            ...|:   .:.|.|:||.||||||:|||||||.|.:||||||:.||:|||:..|||||:||||||
 Frog   167 LPMDKTESESNKGKKRRNRTTFTSYQLEELEKVFQKTHYPDVYAREQLAMRTDLTEARVQVWFQN 231

  Fly   136 RRAKWRKQEKVGPQSHPYNPYLPGGAATMQTVVGAALPPNPFTHLGFQLRKPFDAQHAANLAAFR 200
            |||||||:|:.|               .||                 |:|..|.       :|:.
 Frog   232 RRAKWRKRERFG---------------QMQ-----------------QVRTHFS-------SAYE 257

  Fly   201 YPHLSAAPMIPSGYFNQFQRAPPHMLPHGMAGMYSPSSSFQSLLANMTAVPRGTPLGKPPALLVG 265
            .|.|:.|                    ...|.:.:|     |.:.|...   |:|:   ||.:| 
 Frog   258 LPLLTRA--------------------ENYAQIQNP-----SWIGNNGG---GSPV---PACVV- 290

  Fly   266 SPDLHSPNHMLASPPTSPASGHASQHQQHPTAHPPPPQAPPQ-MPVGVQPAQLSPQHLVGIALTQ 329
                          |....|...|.|     :||.......: :.|....|.:...|:.|:.   
 Frog   291 --------------PCDTVSSCMSPH-----SHPHSAGGVSEFLSVPGPGAHVGQTHMGGLF--- 333

  Fly   330 QASSLSP------TQTSPVALTLSHSPQRQLPPPSHQAPPPPPRAATPPEDRRTSSIAALRLKAR 388
            .::::.|      ..|.|                                ||::|||||||:||:
 Frog   334 GSAAMGPGINGYDLNTEP--------------------------------DRKSSSIAALRMKAK 366

  Fly   389 EH 390
            ||
 Frog   367 EH 368

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
alNP_722629.1 Homeobox 89..141 CDD:278475 40/51 (78%)
OAR 374..391 CDD:281777 13/17 (76%)
alx4XP_004913406.1 COG5576 120..266 CDD:227863 74/206 (36%)
Homeobox 185..238 CDD:365835 41/52 (79%)
OAR 352..370 CDD:367680 13/17 (76%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D454642at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR24329
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
44.020

Return to query results.
Submit another query.