DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment al and arx

DIOPT Version :9

Sequence 1:NP_722629.1 Gene:al / 33208 FlyBaseID:FBgn0000061 Length:408 Species:Drosophila melanogaster
Sequence 2:XP_002933659.1 Gene:arx / 100486727 XenbaseID:XB-GENE-483940 Length:536 Species:Xenopus tropicalis


Alignment Length:357 Identity:127/357 - (35%)
Similarity:164/357 - (45%) Gaps:98/357 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly    54 SGASGASGGTNSPVSDGNSDCEADEYAPKRKQRRYRTTFTSFQLEELEKAFSRTHYPDVFTREEL 118
            |.|.|..|..:..:|.|:   :::|...|||||||||||||:||||||:||.:||||||||||||
 Frog   273 SDADGKDGEDSVCLSAGS---DSEEGMLKRKQRRYRTTFTSYQLEELERAFQKTHYPDVFTREEL 334

  Fly   119 AMKIGLTEARIQVWFQNRRAKWRKQEKVGPQSH-PYNPYLPGGAATMQTVVGAALPPNPFTHLGF 182
            ||::.|||||:|||||||||||||:||.|.|:| |..|: ||       .:.|:.|..|:..   
 Frog   335 AMRLDLTEARVQVWFQNRRAKWRKREKAGAQTHAPGLPF-PG-------PLSASHPLGPYLD--- 388

  Fly   183 QLRKPFDAQHAANLAAFRYPHLSAAPMIPSGYFNQFQRAPPHMLPHGMAGMYSPSSSFQSLLANM 247
              ..||...|.|..:|:.....:||...||        .||.  |||.|.:              
 Frog   389 --ASPFPPHHPALDSAWTAAAAAAAAAFPS--------LPPP--PHGSAAL-------------- 427

  Fly   248 TAVPRGTPLGKPPALLVGSPDLHSPNHMLASPPTSPASGHASQHQQHPTAHPPPPQAPPQMPVGV 312
              .|.|:|||                       .|...|.|                     |..
 Frog   428 --PPSGSPLG-----------------------LSTFLGAA---------------------VFR 446

  Fly   313 QPAQLSPQHLVGIALTQQASSLSPTQTSPVALTLSHSPQRQLPPPSHQAPPPPPRAATPPEDRRT 377
            .||.:||      |..:..|:::|..::..|..|...|...:......:....|  .|...|||.
 Frog   447 HPAFISP------AFGRLFSTMAPLTSASTAAALLRQPSPAVESSVQSSGLSDP--VTAAADRRA 503

  Fly   378 SSIAALRLKAREHE---LKLELLRQNGHGNDV 406
            ||||||||||:||.   .:|.::..|..|.:|
 Frog   504 SSIAALRLKAKEHAAQLTQLNIIPGNSAGKEV 535

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
alNP_722629.1 Homeobox 89..141 CDD:278475 43/51 (84%)
OAR 374..391 CDD:281777 14/16 (88%)
arxXP_002933659.1 Homeobox 305..358 CDD:365835 44/52 (85%)
OAR 500..518 CDD:367680 15/17 (88%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 110 1.000 Domainoid score I6244
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D454642at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - otm47467
Panther 1 1.100 - - O PTHR24329
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X3639
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
66.020

Return to query results.
Submit another query.