DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment al and phox2a

DIOPT Version :9

Sequence 1:NP_722629.1 Gene:al / 33208 FlyBaseID:FBgn0000061 Length:408 Species:Drosophila melanogaster
Sequence 2:NP_001239128.1 Gene:phox2a / 100486496 XenbaseID:XB-GENE-853857 Length:281 Species:Xenopus tropicalis


Alignment Length:258 Identity:84/258 - (32%)
Similarity:104/258 - (40%) Gaps:89/258 - (34%)


- Green bases have known domain annotations that are detailed below.


  Fly    82 KRKQRRYRTTFTSFQLEELEKAFSRTHYPDVFTREELAMKIGLTEARIQVWFQNRRAKWRKQEKV 146
            ||||||.||||||.||:|||:.|:.|||||::||||||:||.|||||:||||||||||:||||: 
 Frog    89 KRKQRRIRTTFTSSQLKELERVFAETHYPDIYTREELALKIDLTEARVQVWFQNRRAKFRKQER- 152

  Fly   147 GPQSHPYNPYLPGGAATMQTVVGAALPPNPFTHLGFQLRKPFDAQHAANLAAFRYPHLSAAPMIP 211
                                                          |||              ..
 Frog   153 ----------------------------------------------AAN--------------SK 157

  Fly   212 SGYFNQ----FQRAPPHMLPHGMAGMYSPSSSFQSLLANMTAVPRGTPLGKPPALLVGSPDLHSP 272
            ||..|.    .:::.|.          |.|...:|..:|.:..|..|      |.|..:.:|:||
 Frog   158 SGSSNNGGSGNKKSDPR----------SSSEDDESKESNCSPTPDST------ASLPTAGNLNSP 206

  Fly   273 NHMLASPPTSPASGHASQHQQHPTAHPPPPQAPPQMPVGV-------QPAQLSPQHLVGIALT 328
            ...| ||.....||..|.|.......|..|..|.......       |||:..|....|:..|
 Frog   207 GGSL-SPSPGAVSGLVSAHTVQALKGPAWPGVPTSSSTSTAELLKAWQPAEAVPGPFAGVLST 268

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
alNP_722629.1 Homeobox 89..141 CDD:278475 40/51 (78%)
OAR 374..391 CDD:281777
phox2aNP_001239128.1 Homeobox 96..148 CDD:278475 40/51 (78%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000011
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
22.000

Return to query results.
Submit another query.