DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment al and LOC100485335

DIOPT Version :9

Sequence 1:NP_722629.1 Gene:al / 33208 FlyBaseID:FBgn0000061 Length:408 Species:Drosophila melanogaster
Sequence 2:XP_002938577.1 Gene:LOC100485335 / 100485335 -ID:- Length:281 Species:Xenopus tropicalis


Alignment Length:270 Identity:82/270 - (30%)
Similarity:111/270 - (41%) Gaps:87/270 - (32%)


- Green bases have known domain annotations that are detailed below.


  Fly    82 KRKQRRYRTTFTSFQLEELEKAFSRTHYPDVFTREELAMKIGLTEARIQVWFQNRRAKWRKQEKV 146
            |||.:|.||:||..|:|.|||.|.||||||||.||.||.||.|.||||||||.|||||||::||:
 Frog    73 KRKLQRNRTSFTQEQIEALEKEFERTHYPDVFARERLAAKIDLPEARIQVWFSNRRAKWRREEKL 137

  Fly   147 GPQSHPYNPYLPGGAATMQTVVGAALPPNPFTHLGFQLRKPFDAQHAANLAAFRYPHLSAAPMIP 211
            ..|                                        .:.|:|.::    |||    |.
 Frog   138 RNQ----------------------------------------RRQASNTSS----HLS----IN 154

  Fly   212 SGYFNQFQRAPPHMLPHGMAGMYSPSSSFQSLLANMTAVPRGTPLGKPPALLVGS-------PDL 269
            |.:.:...::.|           .||:|             |:.||:..|.:..|       |..
 Frog   155 SSFSSSVYQSIP-----------QPSNS-------------GSMLGRSEAAITNSYGSLPPLPSF 195

  Fly   270 HSPNHMLASPPTSPASGHASQHQQHPTAHPPPPQA--PPQMPVGVQPAQLSPQHLVGIALTQQAS 332
            ..||::...|..|..|.::......|:.......|  |||:     ...:|.|:| |...:....
 Frog   196 TMPNNLPIQPIASQTSTYSCMISSSPSVSVRSYDAYTPPQL-----QTHMSNQNL-GSGASSSTG 254

  Fly   333 SLSPTQTSPV 342
            .:||..:.||
 Frog   255 LISPGVSVPV 264

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
alNP_722629.1 Homeobox 89..141 CDD:278475 38/51 (75%)
OAR 374..391 CDD:281777
LOC100485335XP_002938577.1 Homeobox 80..133 CDD:365835 39/52 (75%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000011
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
32.910

Return to query results.
Submit another query.