DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment al and pax10

DIOPT Version :9

Sequence 1:NP_722629.1 Gene:al / 33208 FlyBaseID:FBgn0000061 Length:408 Species:Drosophila melanogaster
Sequence 2:NP_001373372.1 Gene:pax10 / 100192208 ZFINID:ZDB-GENE-081022-10 Length:275 Species:Danio rerio


Alignment Length:270 Identity:86/270 - (31%)
Similarity:108/270 - (40%) Gaps:80/270 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly    42 LTVSMSVSGGAPSGASGASGGTNSPVSDGNSDCEADEYAPKRKQRRYRTTFTSFQLEELEKAFSR 106
            |.|.|:.:|      .|...|....|.|.....:.     |||.:|.||:||..|::.|||.|.|
Zfish    42 LNVQMAGAG------EGVVQGERDEVDDSQLHLQL-----KRKLQRNRTSFTQEQIDALEKEFER 95

  Fly   107 THYPDVFTREELAMKIGLTEARIQVWFQNRRAKWRKQEKVGPQSHPYNPYLPGGAATMQTVVGAA 171
            |||||||.||.||.||.|.||||||||.|||||||::||:..|...     ...::..||     
Zfish    96 THYPDVFARERLAAKIDLPEARIQVWFSNRRAKWRREEKLRNQRRS-----GSSSSCSQT----- 150

  Fly   172 LPPNPFTHLGFQLRKPFDAQHAANLAAFRYPHLSAAPMIPSGY-----FNQFQRAPPHMLPHGMA 231
                 .|.|......|....|.:|.:...:   |.:....|||     |:..|..|....|    
Zfish   151 -----HTPLSTSFNSPVYHSHHSNSSGSMH---SRSDSSLSGYSSLSVFSSMQSLPSQSTP---- 203

  Fly   232 GMYSPSSSFQSLLANMTAVPRGTPLGKPPALLVGSPDLHSPNHMLASPPTSPA--SGHASQHQQH 294
                   ::..:|              ||          ||:   |.||.|..  |.:.|.|.  
Zfish   204 -------TYSCML--------------PP----------SPS---ALPPLSRKFDSSYTSPHL-- 232

  Fly   295 PTAHPPPPQA 304
                ||||.|
Zfish   233 ----PPPPTA 238

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
alNP_722629.1 Homeobox 89..141 CDD:278475 37/51 (73%)
OAR 374..391 CDD:281777
pax10NP_001373372.1 Homeobox 78..131 CDD:395001 38/52 (73%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000011
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.