DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment al and pax3b

DIOPT Version :9

Sequence 1:NP_722629.1 Gene:al / 33208 FlyBaseID:FBgn0000061 Length:408 Species:Drosophila melanogaster
Sequence 2:NP_001315326.1 Gene:pax3b / 100150137 ZFINID:ZDB-GENE-080917-53 Length:469 Species:Danio rerio


Alignment Length:321 Identity:104/321 - (32%)
Similarity:136/321 - (42%) Gaps:73/321 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly    52 APSGASGASG--GTNSPVSDGNSDCEADEYAP-KRKQRRYRTTFTSFQLEELEKAFSRTHYPDVF 113
            |..||....|  ...|..||..|:.|::...| ||||||.|||||:.||||||:||.||||||::
Zfish   186 AHRGAHSIEGILADRSSPSDEGSEVESEPDLPLKRKQRRSRTTFTADQLEELERAFERTHYPDIY 250

  Fly   114 TREELAMKIGLTEARIQVWFQNRRAKWRKQEKVGPQSHPYNPYLPGGAATMQTVVGAALPPNPFT 178
            ||||||.:..|||||:||||.||||:||||.... |...:|..:|||                |:
Zfish   251 TREELAQRAKLTEARVQVWFSNRRARWRKQAGAN-QLMAFNHLIPGG----------------FS 298

  Fly   179 HLGFQLRKPFDAQHAANLAAFRYPHLSAAPMIPSGYFNQFQRAPPHMLPHGMAGMYSPS----SS 239
            |.......|:              .||.:|.            ||..||.....::.|.    ||
Zfish   299 HHAMSSLSPY--------------QLSESPY------------PPAALPQDSGTVHRPQPLPHSS 337

  Fly   240 FQSLLANMTAVPRGTPLGKPPAL-----LVGSPDLHSP-----NHMLASPPTSPASGHASQHQQH 294
            .||   :..|.|.|   |....|     ..|..|...|     |:.:.:..:|...|..:     
Zfish   338 HQS---SGGAGPEG---GASYCLSSRHGYTGYSDAFGPHNTHNNNAINNGLSSQVMGLIT----- 391

  Fly   295 PTAHPPPPQAPPQMPVGVQPAQLSPQHLVGIALTQQASSLSPTQ--TSPVALTLSHSPQRQ 353
            |:....|.||...:..|...:....|.:..::.....|:||..|  :|....:|.||...|
Zfish   392 PSGASHPTQAEFSLDSGSSVSSSCSQRMESLSSLPALSNLSNPQSYSSASFYSLEHSGHYQ 452

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
alNP_722629.1 Homeobox 89..141 CDD:278475 38/51 (75%)
OAR 374..391 CDD:281777
pax3bNP_001315326.1 None
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000011
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
32.910

Return to query results.
Submit another query.