DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment al and phox2b

DIOPT Version :9

Sequence 1:NP_722629.1 Gene:al / 33208 FlyBaseID:FBgn0000061 Length:408 Species:Drosophila melanogaster
Sequence 2:NP_001116492.1 Gene:phox2b / 100124329 XenbaseID:XB-GENE-1000415 Length:293 Species:Xenopus tropicalis


Alignment Length:276 Identity:91/276 - (32%)
Similarity:119/276 - (43%) Gaps:104/276 - (37%)


- Green bases have known domain annotations that are detailed below.


  Fly    33 SSAASAGAALTVSMSVSG----------GAPSGASGASGGTNSPVSDGN-SDCEADEYA------ 80
            ||.|||.|..:.....||          ||.||....:.|:   .|.|. .|.::..||      
 Frog    24 SSLASAYADFSSCSQASGFQYNPIRTTFGATSGCPSLTPGS---CSLGTLRDHQSSPYAAVPYKL 85

  Fly    81 --------PKRKQRRYRTTFTSFQLEELEKAFSRTHYPDVFTREELAMKIGLTEARIQVWFQNRR 137
                    .||||||.||||||.||:|||:.|:.|||||::||||||:||.|||||:||||||||
 Frog    86 FTDHGGLNEKRKQRRIRTTFTSAQLKELERVFAETHYPDIYTREELALKIDLTEARVQVWFQNRR 150

  Fly   138 AKWRKQEKV-------------------------------------GPQSHPYNPY--------- 156
            ||:||||:.                                     ||.::| ||.         
 Frog   151 AKFRKQERAAAAAAAAAKNGSSGKKSDSSRDEESKDSKSADPDSTGGPGNNP-NPTPSCGGGPSP 214

  Fly   157 ----------------LPG-GAATMQTVVG--------AALPPNPFTHLGFQLRKPFDAQHAANL 196
                            :|| |:.|..:|||        |..|....|.:...|..||    |:.|
 Frog   215 SGAQGNGVPQEPGKVGVPGPGSLTSASVVGVSGGPQGWATGPGGTITSIPDSLGGPF----ASVL 275

  Fly   197 AAFRYPHLSAAPMIPS 212
            ::.:.|:.:.|.::.|
 Frog   276 SSLQRPNSTKATLVKS 291

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
alNP_722629.1 Homeobox 89..141 CDD:278475 40/51 (78%)
OAR 374..391 CDD:281777
phox2bNP_001116492.1 Homeobox 102..154 CDD:278475 40/51 (78%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000011
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.