DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ent1 and AT4G05140

DIOPT Version :9

Sequence 1:NP_001259820.1 Gene:Ent1 / 33207 FlyBaseID:FBgn0031250 Length:476 Species:Drosophila melanogaster
Sequence 2:NP_192423.1 Gene:AT4G05140 / 825861 AraportID:AT4G05140 Length:419 Species:Arabidopsis thaliana


Alignment Length:455 Identity:102/455 - (22%)
Similarity:192/455 - (42%) Gaps:91/455 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly    58 PES--GRLFTYLVFYLLGIGTMTPWNFFVTAEDYWKYKFRNASINNTDLEEELTPLQKSFTCDLA 120
            ||:  |:....:|..:||||::..||..::..||:...|.:...:..     ||.:.:.|:.   
plant    10 PENLHGKYQAMVVCCILGIGSLVSWNSLLSVGDYYYQVFPDYHPSRV-----LTFVYQPFSI--- 66

  Fly   121 LTATISGTTFLLLNAIFGHHVS-LRTK---MLG------TLWMILILFGVTTGFVEINTDTWQEQ 175
                  ||.     .||.::.| :.|:   ::|      ::::::||...|.|...|..      
plant    67 ------GTI-----VIFAYNESKINTRKRNLIGYIVFTTSIFLLIILDLATKGHGGIGP------ 114

  Fly   176 FFLITLIIVVLLNISAATMSGALYGVAGLFPSEFITAVVSGQALGGILTALAFILV--LAFD--- 235
             :::...||.....:.|::.|.:.|...|...|.|.:.|:|.|:.|.||: ||.|:  .||:   
plant   115 -YIVLCAIVGSFGFADASVRGGMIGDLSLMCPELIQSFVAGLAVAGALTS-AFRLITKAAFEKTH 177

  Fly   236 TGPNTTAFIFFIVGGVLILLCIVCYV-ILARKPFFRYY-----LEGGDKYKVIRAVPSHNRNGSA 294
            .|....|.||..:..::..||::.|. :..:.|..:||     .||.   |.:.|      :.:|
plant   178 DGLRKGAMIFLAISTLVEFLCVLLYAYVFPKLPIVKYYRSKAASEGS---KTVYA------DLAA 233

  Fly   295 EGLPLEPIL--------RQVMSKIYL-----HAISLALLYTTTLSVYPAVTVLMQSEYGHSVWTD 346
            .|:..:.:|        :::.:|..|     :.::|.|:|..|||:.|........::|...|  
plant   234 AGIQNQSVLTADDVSKDKRLNNKELLLENVDYVVNLFLIYVLTLSILPGFLYENTGQHGLGSW-- 296

  Fly   347 VYFLPVVNYLIFNCGDYFGRL--FAGWMERPLNQNTSLLFIVVRMAFVPLF-LCSNSSEHSFLPV 408
             |.|.::  .::|..|..||.  ...|:... |:....:.::.|...||.| ..:...:..::.:
plant   297 -YALVLI--AMYNWWDLVGRYIPMVKWLNVE-NRKGLTVAVLTRFLLVPAFYFTAKYGDQGWMIL 357

  Fly   409 LVKHDYTFIAMMVMFALSNGYFTNILLIMAPKRVKQHEKELASSIMAAALSCGMAVGSLLSLVFV 473
            ||.          :..|:||:.|..:|..||:.....||....:::...:..|..||..|..:::
plant   358 LVS----------ILGLTNGHLTVCILAKAPRGYTGPEKNALGNLLVLFILWGAFVGCALGWLWL 412

  Fly   474  473
            plant   413  412

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ent1NP_001259820.1 Nucleoside_tran 69..476 CDD:301621 98/442 (22%)
AT4G05140NP_192423.1 Nucleoside_tran 25..411 CDD:301621 98/437 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1479
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG53699
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - mtm1046
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR10332
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
76.880

Return to query results.
Submit another query.