DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ent1 and slc29a1

DIOPT Version :9

Sequence 1:NP_001259820.1 Gene:Ent1 / 33207 FlyBaseID:FBgn0031250 Length:476 Species:Drosophila melanogaster
Sequence 2:NP_001015718.1 Gene:slc29a1 / 548435 XenbaseID:XB-GENE-6454898 Length:455 Species:Xenopus tropicalis


Alignment Length:461 Identity:150/461 - (32%)
Similarity:244/461 - (52%) Gaps:58/461 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly    54 VSNEPESGRLFTYLVFYLLGIGTMTPWNFFVTAEDYWKYKF------------------------ 94
            ::|.|.......:|:|::||:||:.|||||:||..|:..:.                        
 Frog     1 MANPPTDRYNAVWLIFFILGLGTLLPWNFFMTATMYFTSRLAEPGVPRENSVLTPPSVTEPPNSP 65

  Fly    95 RNASINNTDLEEELTPLQKSFTCDLALTATISGTTFLLLNAIFGHHVSLRTKMLGTLWMILILFG 159
            .::|....|:....|.||..|...:.|.|.:....|..||:.....:|...::.|||..|.::|.
 Frog    66 NDSSTRADDMGGHQTYLQSKFNNVMTLCAMLPLLIFTCLNSFLHQRISQNIRIGGTLLAIFLIFL 130

  Fly   160 VTTGFVEINTDTWQEQFFLITLIIVVLLNISAATMSGALYGVAGLFPSEFITAVVSGQALGGILT 224
            :|..||::...  ...||.:|:|.:|.:|...|.:.|:|:|:|.|||:.:.:.::|||.|.|...
 Frog   131 LTAIFVKVPFS--PVSFFTVTMIKIVFINSFGAILQGSLFGLAALFPANYTSPIMSGQGLAGAFA 193

  Fly   225 ALAFILVLAFDTGPNTTAFIFFIVGGVLILLCIVCYVILARKPFFRYY-LEGGDKYKVIRAVPS- 287
            ||:.|..||..:....:||.:||...|:|||.::.||.|.:..|:||| :|     .|..|.|: 
 Frog   194 ALSMICALASGSALEDSAFGYFITACVVILLALLSYVALNKLEFYRYYTIE-----NVSAAAPAE 253

  Fly   288 --------HNRNGSAE-----GLPLEPILRQVMSKIYLHAISLALLYTTTLSVYPAVTVLMQSEY 339
                    .|..|.||     |...:.:: |::.|:::.|:|:.|::..|:.::||||..::|..
 Frog   254 IELKKDLLENGGGVAETGAESGDGGKSVI-QILKKVWVLALSVCLVFGVTIGIFPAVTADVKSTI 317

  Fly   340 -GHSVWTDVYFLPVVNYLIFNCGDYFGR---LFAGWMERPLNQNTSL--LFIVVRMAFVPLFLCS 398
             |.|.| .:||:||..:|:||..|:.||   :...|.    .|::.|  |.:..|:.|:|||:..
 Frog   318 AGESKW-GIYFIPVSCFLLFNLFDWAGRSLTVLTMWP----GQDSKLLPLLVAARLVFLPLFMLC 377

  Fly   399 NSSEHSFLPVLVKHDYTFIAMMVMFALSNGYFTNILLIMAPKRVKQHEKELASSIMAAALSCGMA 463
            |.|..::||||:.||..:|.:|::||:||||..::.:...||:|..||.|.|.:|||..||.|:|
 Frog   378 NVSPRTYLPVLLAHDAWYICIMILFAVSNGYLASLCMCFGPKKVGVHEAETAGAIMAFFLSLGLA 442

  Fly   464 VGSLLS 469
            :|:.||
 Frog   443 LGAGLS 448

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ent1NP_001259820.1 Nucleoside_tran 69..476 CDD:301621 147/446 (33%)
slc29a1NP_001015718.1 2a57 16..455 CDD:273352 147/446 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 178 1.000 Domainoid score I3501
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 1 1.000 - - H37985
Inparanoid 1 1.050 229 1.000 Inparanoid score I3374
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D318009at33208
OrthoFinder 1 1.000 - - FOG0000541
OrthoInspector 1 1.000 - - otm48471
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X296
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
77.060

Return to query results.
Submit another query.