DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ent1 and Ent2

DIOPT Version :9

Sequence 1:NP_001259820.1 Gene:Ent1 / 33207 FlyBaseID:FBgn0031250 Length:476 Species:Drosophila melanogaster
Sequence 2:NP_001285680.1 Gene:Ent2 / 33921 FlyBaseID:FBgn0263916 Length:458 Species:Drosophila melanogaster


Alignment Length:421 Identity:113/421 - (26%)
Similarity:201/421 - (47%) Gaps:30/421 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly    58 PESGRLFTYLVFYLLGIGTMTPWNFFVTAEDYWK-YKFRNASINNTDLEEELTPLQKSFTCDLAL 121
            |:...|..:.:|.|.|:||:.|||.|:||:.|:: :||   ..|||...|  ...:..|..::..
  Fly    51 PKDKFLIVFFIFLLHGVGTLMPWNMFITAKSYFEDFKF---GPNNTVATE--VSYRTHFMQNMGF 110

  Fly   122 TATISGTTFLLLNAIFGHHVSLRTKMLGTLWMILILFGVTTGFVEINTDTWQEQFFLITLIIVVL 186
            .:.|....|..||........|.|:::.::...:::..||.....:::..|...||..|::.:||
  Fly   111 ASQIPNLVFNWLNIFVNFGGDLTTRIVYSIIFEMVILLVTIILAMLDSSQWPGVFFWTTMVCIVL 175

  Fly   187 LNISAATMSGALYGVAGLFPSEFITAVVSGQALGG-ILTALAFILVLAFDTGPNTTAFIFFIVGG 250
            ||:........:||:....|.::..|||.|..:.| ..||:|.|....| :...|:|..:|:...
  Fly   176 LNVCNGIYQNTIYGIVASLPIKYTGAVVLGSNISGCFTTAMALICGEIF-SSKRTSAIYYFVTAI 239

  Fly   251 VLILLCIVCYVILARKPFFRYYLEGGDKYKVIRAVPSHNRNGSAEGLPLEPILRQVMSKIYLHAI 315
            :::|||...|..|....|||:|      ..:.|:....:.:.:...:|...|.::...:::    
  Fly   240 LVLLLCFDTYFALPLNKFFRHY------ETISRSSEKKSDSKAQLNVPYWQIFKKAAPQLF---- 294

  Fly   316 SLALLYTTTLSVYPAV-TVLMQSEYGHSVWTDVYFLPVVNYLIFNCGDYFGRLFAGWMERPLNQN 379
            ::.|.:..||||:||: :.:.:|:....|..| ||..|..:..||.....|.|...|::.|   .
  Fly   295 NIFLTFFVTLSVFPAIQSNVHRSDPNFVVGPD-YFTLVTCFATFNVFAMLGSLTTSWVQWP---G 355

  Fly   380 TSLLF--IVVRMAFVPLFLCSN----SSEHSFLPVLVKHDYTFIAMMVMFALSNGYFTNILLIMA 438
            ...|:  :|:|:||:|||:..|    .|..| |.|.:::|:.:..:.:..|.|:||.:::.::.|
  Fly   356 PRFLWVPVVLRLAFIPLFVMCNYVPPDSVRS-LAVFIENDWVYWGIGIAMAYSSGYLSSLGMMYA 419

  Fly   439 PKRVKQHEKELASSIMAAALSCGMAVGSLLS 469
            |:.|....:..|....||.|..|:..|.|.|
  Fly   420 PQTVHTKYQTTAGMYAAAMLITGIFSGVLFS 450

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ent1NP_001259820.1 Nucleoside_tran 69..476 CDD:301621 111/410 (27%)
Ent2NP_001285680.1 Nucleoside_tran 62..457 CDD:301621 111/410 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45448994
Domainoid 1 1.000 71 1.000 Domainoid score I9372
eggNOG 1 0.900 - - E1_KOG1479
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 1 0.950 - 0 Normalized mean entropy S3732
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D318009at33208
OrthoFinder 1 1.000 - - FOG0000541
OrthoInspector 1 1.000 - - mtm1046
orthoMCL 1 0.900 - - OOG6_100863
Panther 1 1.100 - - P PTHR10332
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R2123
SonicParanoid 1 1.000 - - X296
1211.730

Return to query results.
Submit another query.