DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ent1 and LOC100334018

DIOPT Version :9

Sequence 1:NP_001259820.1 Gene:Ent1 / 33207 FlyBaseID:FBgn0031250 Length:476 Species:Drosophila melanogaster
Sequence 2:XP_002663054.4 Gene:LOC100334018 / 100334018 -ID:- Length:460 Species:Danio rerio


Alignment Length:447 Identity:132/447 - (29%)
Similarity:229/447 - (51%) Gaps:52/447 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly    67 LVFYLLGIGTMTPWNFFVTAEDYWKYKFRNASINNTDLEEELTPLQKSFTCDLALTATISGTTFL 131
            ::|::||:||:.|||||:||..|:..:...:...|..:   .:..:..|...:.|.:.:....|.
Zfish    15 IIFFILGLGTLLPWNFFMTASMYFNKRLNTSESGNGTI---ASGKEYYFNNWMTLLSQLPLLLFT 76

  Fly   132 LLNAIFGHHVSLRTKMLGTLWMILILFGVTTGFVEINTDTWQEQFFLITLIIVVLLNISAATMSG 196
            |||:|....:|.:.::.|:|..|.:||.:|...|.|..:  :::||.||:..:..:|...|.:.|
Zfish    77 LLNSILYPRISEKMRIGGSLVFIFLLFFLTAVLVMIPME--EDRFFSITMATIWFINSFGAVLQG 139

  Fly   197 ALYGVAGLFPSEFITAVVSGQALGGILTALAFILVLAFDTGPNTTAFIFFIVGGVLILLCIVCYV 261
            :|:|:.||.|.::....:|||.|.|...|||.|..:|.:...::.|..:||...|..|:.:..|:
Zfish   140 SLFGLVGLLPQKYSAVFMSGQGLAGTFAALAMIFAIASEAKSDSAALGYFITPCVGTLITLFSYM 204

  Fly   262 ILARKPFFRYYLEG-GDKYK--------------------------VIRAVPSHNRNGSAE---- 295
            :|.:..|.|:|||. |..|:                          |....||:..|..:|    
Zfish   205 MLPKLEFARFYLENKGKSYELETSRELLPTGDAEVSEKTSEPLNGPVANGTPSNGINSVSEEDSG 269

  Fly   296 -----GLPLEPI------LRQVMSKIYLHAISLALLYTTTLSVYPAVTVLMQSEYGHSVWTDVYF 349
                 .|..|..      :.||..||::.|..:..::..||||:|||||.:::.|| ..| :.||
Zfish   270 KQAFISLQQESASTQKSSVIQVFRKIWVMAFCVTFVFIVTLSVFPAVTVDVKTAYG-GKW-EQYF 332

  Fly   350 LPVVNYLIFNCGDYFGRLFAGWMERPLNQNTSL--LFIVVRMAFVPLFLCSNSSEHSFLPVLVKH 412
            :||..:|.||..|:.||......:.| ::::.|  |.:|.|:.||||.:..|..:...||||..:
Zfish   333 IPVFCFLCFNLCDWAGRTVTSVFKWP-HKDSRLFPLLVVSRVIFVPLLMMCNVQDRQNLPVLFSN 396

  Fly   413 DYTFIAMMVMFALSNGYFTNILLIMAPKRVKQHEKELASSIMAAALSCGMAVGSLLS 469
            |:.|:.:|::|::|:|||..:.:..||:.|:..:.|.|.::|...|:.|:::|:.:|
Zfish   397 DFIFVFIMLLFSVSSGYFVCLSMTYAPQLVEPKDAETAGALMTFFLALGLSLGAAIS 453

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ent1NP_001259820.1 Nucleoside_tran 69..476 CDD:301621 132/445 (30%)
LOC100334018XP_002663054.4 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D318009at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.