DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11911 and TMPRSS5

DIOPT Version :9

Sequence 1:NP_608518.1 Gene:CG11911 / 33206 FlyBaseID:FBgn0031249 Length:277 Species:Drosophila melanogaster
Sequence 2:NP_110397.2 Gene:TMPRSS5 / 80975 HGNCID:14908 Length:457 Species:Homo sapiens


Alignment Length:250 Identity:72/250 - (28%)
Similarity:111/250 - (44%) Gaps:39/250 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly    37 VINGTEAEPHSAPYIVSLATNYLKHSHICGGTLINKDWIVTAAHC-----ISEPVGMSIIAGL-- 94
            ::.|....|...|:..|:|..:   .|.|||:::...|:||||||     ::......:.|||  
Human   218 IVGGQSVAPGRWPWQASVALGF---RHTCGGSVLAPRWVVTAAHCMHSFRLARLSSWRVHAGLVS 279

  Fly    95 ------HTRAEVDELTQQRQVDFGRVHEKYTGGVGPYDIALLHVNESFIFNEWVQPATLPSREQV 153
                  |..|.|:.:..         |..|:.....||:|||.:..:..|::.|....||::||.
Human   280 HSAVRPHQGALVERIIP---------HPLYSAQNHDYDVALLRLQTALNFSDTVGAVCLPAKEQH 335

  Fly   154 HEGETHLY--GWGQP-KSYIFSGAKTLQTVTTQILNYEECKEELPESAPIAESNICSSSLQQSKS 215
            ....:..:  |||.. .|:.:| :..||.....:.:.:.|......|..:....:|:..|.....
Human   336 FPKGSRCWVSGWGHTHPSHTYS-SDMLQDTVVPLFSTQLCNSSCVYSGALTPRMLCAGYLDGRAD 399

  Fly   216 ACNGDSGGPLVVEFTNAPS----ELIGIVSWGYIPCGLANMPSIYTKVSAYIDWI 266
            ||.||||||||     .|.    .|:|:||||. .|...|.|.:|.||:.::|||
Human   400 ACQGDSGGPLV-----CPDGDTWRLVGVVSWGR-GCAEPNHPGVYAKVAEFLDWI 448

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11911NP_608518.1 Tryp_SPc 37..269 CDD:238113 71/249 (29%)
Tryp_SPc 37..266 CDD:214473 70/248 (28%)
TMPRSS5NP_110397.2 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..21
SRCR_2 116..213 CDD:292133
Tryp_SPc 217..448 CDD:214473 70/248 (28%)
Tryp_SPc 218..451 CDD:238113 71/249 (29%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D433637at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.