DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11911 and Prss36

DIOPT Version :9

Sequence 1:NP_608518.1 Gene:CG11911 / 33206 FlyBaseID:FBgn0031249 Length:277 Species:Drosophila melanogaster
Sequence 2:XP_017167884.1 Gene:Prss36 / 77613 MGIID:1924863 Length:863 Species:Mus musculus


Alignment Length:263 Identity:74/263 - (28%)
Similarity:113/263 - (42%) Gaps:56/263 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly    37 VINGTEAEPHSAPYIVSLATNYLKHSHICGGTLINKDWIVTAAHCI-----SEPVG-MSIIAGLH 95
            ::.|::|.|.:.|:.|||   :....|||||:||...|:::||||.     .||.. :|::.|:|
Mouse    48 IVGGSDAHPGTWPWQVSL---HQGGGHICGGSLIAPSWVLSAAHCFVTNGTLEPADELSVLLGVH 109

  Fly    96 TRAEVDELTQQRQVDFGRVHEKYTGGVGPYDIALLHVNESFIFNEWVQPATLPSREQVHEGETHL 160
            ::....|....|.|....:.:.|:......|:|||.:.........|:|..||.       .:||
Mouse   110 SQDGPLEGAHMRSVATILIPDNYSTVELGADLALLRLASPAKLGPSVRPVCLPR-------ASHL 167

  Fly   161 Y---------GWGQ-------PKSYIFSGAKTLQTVTTQILNYEECKEELPESAP------IAES 203
            :         |||.       |..::      ||.|..::|....|:.......|      :...
Mouse   168 FAHGTACWATGWGDVQEAVPLPLPWV------LQEVELRLLGEAACQCLYSRPGPFNLTFQLLPG 226

  Fly   204 NICSSSLQQSKSACNGDSGGPLVVE-----FTNAPSELIGIVSWGYIPCGLANMPSIYTKVSAYI 263
            .:|:......:..|.||||||||.|     |      |.||.|:|: .||..|.|.::|.|:.|.
Mouse   227 MLCAGYPAGRRDTCQGDSGGPLVCEDGGRWF------LAGITSFGF-GCGRRNRPGVFTAVAPYE 284

  Fly   264 DWI 266
            .||
Mouse   285 SWI 287

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11911NP_608518.1 Tryp_SPc 37..269 CDD:238113 74/263 (28%)
Tryp_SPc 37..266 CDD:214473 72/261 (28%)
Prss36XP_017167884.1 Tryp_SPc 48..290 CDD:238113 74/263 (28%)
Tryp_SPc 331..532 CDD:389826
Tryp_SPc 607..789 CDD:389826
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D433637at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.