DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11911 and Prss44

DIOPT Version :9

Sequence 1:NP_608518.1 Gene:CG11911 / 33206 FlyBaseID:FBgn0031249 Length:277 Species:Drosophila melanogaster
Sequence 2:NP_683742.2 Gene:Prss44 / 73336 MGIID:1920586 Length:372 Species:Mus musculus


Alignment Length:260 Identity:81/260 - (31%)
Similarity:127/260 - (48%) Gaps:43/260 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly    30 PSFATGF----VINGTEAEPHSAPYIVSLATNYLKHSHICGGTLINKDWIVTAAHCISEPVGMSI 90
            |:.|.|.    ::.|..|.....|:.|||..:   ..|||||:||:|.|::|||||:...:..::
Mouse   101 PTSACGHRTARIVGGRPAPARKWPWQVSLQVH---KQHICGGSLISKWWVITAAHCVYGHLDYAV 162

  Fly    91 IAG---LHTRAEV-----DELTQQRQVDFGRVHEKYTGGVGPYDIALLHVNESFIFNEWVQPATL 147
            ..|   |.::..|     |.:..|   ||..:....      :||||:.:.....::..:||..:
Mouse   163 FMGDADLWSKRPVRIPVQDIIVHQ---DFSMMRTVV------HDIALVLLAFPVNYSVNIQPVCI 218

  Fly   148 PSREQVHEGETHLY--GWG----QPKSYIFSGAKTLQTVTTQILNYEECKEELPE-----SAPIA 201
            |.:..:.:..|..:  |||    |.:|     ::.||.:...|:.:|:|.:.|.:     ...:.
Mouse   219 PEKSFLVQPGTLCWVTGWGKVLEQGRS-----SRILQEIELNIIRHEKCNQILKDIMGNIFTLVQ 278

  Fly   202 ESNICSSSLQQSKSACNGDSGGPLVVEFTNAPSELIGIVSWGYIPCGLANMPSIYTKVSAYIDWI 266
            |..:|..: ::...||.||||||||.|| |.....:|||||| :.||....|.:||:||.|.|||
Mouse   279 EGGVCGYN-EKGGDACQGDSGGPLVCEF-NKTWVQVGIVSWG-LGCGRIGYPGVYTEVSYYRDWI 340

  Fly   267  266
            Mouse   341  340

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11911NP_608518.1 Tryp_SPc 37..269 CDD:238113 78/249 (31%)
Tryp_SPc 37..266 CDD:214473 76/247 (31%)
Prss44NP_683742.2 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 31..72
Tryp_SPc 111..340 CDD:214473 76/248 (31%)
Tryp_SPc 112..340 CDD:238113 76/247 (31%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D433637at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.