DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11911 and C1R

DIOPT Version :10

Sequence 1:NP_608518.1 Gene:CG11911 / 33206 FlyBaseID:FBgn0031249 Length:277 Species:Drosophila melanogaster
Sequence 2:NP_001341275.1 Gene:C1R / 715 HGNCID:1246 Length:719 Species:Homo sapiens


Alignment Length:254 Identity:72/254 - (28%)
Similarity:107/254 - (42%) Gaps:44/254 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly    37 VINGTEAEPHSAPYIVSLATNYLKHSHICGGTLINKDWIVTAAHCI-------SEPVGMSIIAGL 94
            :|.|.:|:..:.|:  .:.||.  |.. .||.|:...||:||||.:       .....:.:..| 
Human   478 IIGGQKAKMGNFPW--QVFTNI--HGR-GGGALLGDRWILTAAHTLYPKEHEAQSNASLDVFLG- 536

  Fly    95 HTRAEVDELTQQ-----RQVDFGRVHEKYTGGVGPY----DIALLHVNESFIFNEWVQPATLPSR 150
            ||  .|:||.:.     |:|.   ||..|..... |    |||||.:..|......:.|..||..
Human   537 HT--NVEELMKLGNHPIRRVS---VHPDYRQDES-YNFEGDIALLELENSVTLGPNLLPICLPDN 595

  Fly   151 EQVHE----GETHLYGWGQPKSYIFSGAKTLQTVTTQILNYEECKEEL---PESAPIAESNICSS 208
            :..::    |  ::.|:|..:..|   |..|:.|...:.|.:.|:..|   ......:::..|:.
Human   596 DTFYDLGLMG--YVSGFGVMEEKI---AHDLRFVRLPVANPQACENWLRGKNRMDVFSQNMFCAG 655

  Fly   209 SLQQSKSACNGDSGGPLVVEFTNAPSEL-IGIVSWGYIPCGLANMPSIYTKVSAYIDWI 266
            .....:.||.|||||...|...|....: .||||||   .|.:.....||||..|:|||
Human   656 HPSLKQDACQGDSGGVFAVRDPNTDRWVATGIVSWG---IGCSRGYGFYTKVLNYVDWI 711

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11911NP_608518.1 Tryp_SPc 37..266 CDD:214473 70/252 (28%)
C1RNP_001341275.1 CUB 41..152 CDD:214483
FXa_inhibition 175..203 CDD:464251
CUB 207..316 CDD:395345
Sushi 323..385 CDD:459664
CCP 390..461 CDD:153056
Tryp_SPc 477..711 CDD:214473 70/252 (28%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.