DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11911 and C1R

DIOPT Version :9

Sequence 1:NP_608518.1 Gene:CG11911 / 33206 FlyBaseID:FBgn0031249 Length:277 Species:Drosophila melanogaster
Sequence 2:NP_001341275.1 Gene:C1R / 715 HGNCID:1246 Length:719 Species:Homo sapiens


Alignment Length:254 Identity:72/254 - (28%)
Similarity:107/254 - (42%) Gaps:44/254 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly    37 VINGTEAEPHSAPYIVSLATNYLKHSHICGGTLINKDWIVTAAHCI-------SEPVGMSIIAGL 94
            :|.|.:|:..:.|:  .:.||.  |.. .||.|:...||:||||.:       .....:.:..| 
Human   478 IIGGQKAKMGNFPW--QVFTNI--HGR-GGGALLGDRWILTAAHTLYPKEHEAQSNASLDVFLG- 536

  Fly    95 HTRAEVDELTQQ-----RQVDFGRVHEKYTGGVGPY----DIALLHVNESFIFNEWVQPATLPSR 150
            ||  .|:||.:.     |:|.   ||..|..... |    |||||.:..|......:.|..||..
Human   537 HT--NVEELMKLGNHPIRRVS---VHPDYRQDES-YNFEGDIALLELENSVTLGPNLLPICLPDN 595

  Fly   151 EQVHE----GETHLYGWGQPKSYIFSGAKTLQTVTTQILNYEECKEEL---PESAPIAESNICSS 208
            :..::    |  ::.|:|..:..|   |..|:.|...:.|.:.|:..|   ......:::..|:.
Human   596 DTFYDLGLMG--YVSGFGVMEEKI---AHDLRFVRLPVANPQACENWLRGKNRMDVFSQNMFCAG 655

  Fly   209 SLQQSKSACNGDSGGPLVVEFTNAPSEL-IGIVSWGYIPCGLANMPSIYTKVSAYIDWI 266
            .....:.||.|||||...|...|....: .||||||   .|.:.....||||..|:|||
Human   656 HPSLKQDACQGDSGGVFAVRDPNTDRWVATGIVSWG---IGCSRGYGFYTKVLNYVDWI 711

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11911NP_608518.1 Tryp_SPc 37..269 CDD:238113 72/254 (28%)
Tryp_SPc 37..266 CDD:214473 70/252 (28%)
C1RNP_001341275.1 CUB 41..152 CDD:214483
FXa_inhibition 175..203 CDD:317114
CUB 207..316 CDD:278839
Sushi 323..385 CDD:306569
Sushi 390..461 CDD:306569
Tryp_SPc 477..711 CDD:214473 70/252 (28%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.